close

SimulationCraft 725-01

for World of Warcraft 7.2.5 Live (wow build level 24287, git build f220cdb)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

T19 2pc : 1311547 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1311547.4 1311547.4 2074.2 / 0.158% 200297.0 / 15.3% 39.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
25029.3 25029.3 Mana 0.00% 48.8 100.1% 100%
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Channel Demonfire (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T19 2pc 1311547
Channel Demonfire 0 (162605) 0.0% (12.4%) 16.1 19.03sec 3029839 1251017

Stats details: channel_demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.14 0.00 241.23 0.00 2.4219 0.1453 0.00 0.00 0.00 1251017.28 1251017.28
 
 

Action details: channel_demonfire

Static Values
  • id:196447
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:52800.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
Spelldata
  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Channel Demonfire (_tick) 162605 12.4% 0.0 0.00sec 0 0 Direct 237.8 165158 330193 205621 24.5%  

Stats details: channel_demonfire_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 237.81 0.00 0.00 0.0000 0.0000 48897261.36 48897261.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.50 75.48% 165157.78 120066 242678 165342.78 155860 182052 29645398 29645398 0.00
crit 58.31 24.52% 330192.56 240138 485356 330578.61 305792 371517 19251864 19251864 0.00
 
 

Action details: channel_demonfire_tick

Static Values
  • id:196448
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Chaos Bolt 329615 25.2% 38.7 7.69sec 2564538 1635303 Direct 39.5 0 2510946 2510946 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.67 39.49 0.00 0.00 1.5682 0.0000 99169654.08 99169654.08 0.00 1635302.58 1635302.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 39.49 100.00% 2510946.23 1825772 3764124 2511750.59 2387544 2697290 99169654 99169654 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=1}} Chaos damage. Damage is further increased by your critical strike chance.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 108113 8.3% 35.3 8.60sec 920113 840591 Direct 35.3 491575 1184076 920104 61.9%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.34 35.34 0.00 0.00 1.0946 0.0000 32518259.82 32518259.82 0.00 840590.92 840590.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.47 38.12% 491575.30 359060 725133 491993.13 436275 573289 6622172 6622172 0.00
crit 21.87 61.88% 1184075.64 718128 1826902 1184892.87 1048462 1371112 25896088 25896088 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 6597 0.5% 13.9 2.13sec 140107 0 Direct 13.9 112750 225102 140093 24.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.92 13.92 0.00 0.00 0.0000 0.0000 1950942.69 1950942.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.53 75.65% 112750.08 98855 130488 112756.60 101326 126864 1187661 1187661 0.00
crit 3.39 24.35% 225101.78 197709 260976 221399.90 0 260976 763282 763282 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 109331 8.4% 17.2 17.92sec 1912650 1710936 Direct 17.2 267755 533296 421477 57.9%  
Periodic 136.1 119771 239075 188568 57.7% 98.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.22 17.22 136.14 136.14 1.1179 2.1871 32928681.83 32928681.83 0.00 103873.35 1710936.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.25 42.12% 267754.97 198313 399418 267805.42 0 341900 1941394 1941394 0.00
crit 9.97 57.88% 533295.55 396640 801068 533506.69 467279 625012 5314697 5314697 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.6 42.33% 119771.17 59 179424 119874.04 111636 127708 6903021 6903021 0.00
crit 78.5 57.67% 239074.79 105 358870 239231.52 227893 254648 18769569 18769569 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 184824 14.1% 101.1 2.89sec 550795 470984 Direct 100.7 440344 877424 553100 25.8%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.10 100.68 0.00 0.00 1.1695 0.0000 55687226.81 55687226.81 0.00 470983.68 470983.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.70 74.20% 440344.19 330249 667451 440663.43 420780 464737 32895083 32895083 0.00
crit 25.98 25.80% 877423.73 660542 1334732 878110.10 812502 969858 22792144 22792144 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:55000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.84
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Insidious Corruption 13602 1.0% 5.1 60.48sec 807859 0 Periodic 42.9 77103 154132 95680 24.1% 19.8%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.08 0.00 42.86 42.86 0.0000 1.3956 4100764.94 4100764.94 0.00 68560.91 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.5 75.88% 77102.56 1309 103505 77078.71 71989 82613 2507259 2507259 0.00
crit 10.3 24.12% 154131.91 2618 188191 154077.87 84558 172508 1593506 1593506 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Spectral Owl 0 (73848) 0.0% (5.6%) 3.0 120.40sec 7299341 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.03 0.00 57.65 0.00 0.0000 1.0000 0.00 0.00 0.00 383393.73 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 22901 1.7% 33.4 8.00sec 204982 0 Direct 33.2 166577 333340 206458 23.9%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.43 33.19 0.00 0.00 0.0000 0.0000 6853055.63 6853055.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.26 76.09% 166577.30 138719 183108 166607.66 155087 179166 4207057 4207057 0.00
crit 7.94 23.91% 333340.48 277437 366217 333518.36 277437 366217 2645998 2645998 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
    Spectral Bolt 50946 3.9% 86.1 3.06sec 177163 0 Direct 85.7 143305 286470 177977 24.2%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.08 85.68 0.00 0.00 0.0000 0.0000 15249593.08 15249593.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.92 75.78% 143304.84 118901 156949 143335.67 136825 149495 9304033 9304033 0.00
crit 20.75 24.22% 286470.19 237802 313898 286510.32 254448 310093 5945560 5945560 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90466.53
  • base_dd_max:99989.32
 
pet - infernal 108560 / 1164
Immolation 45789 0.0% 1.0 0.00sec 145297 0 Periodic 2.0 58285 116601 72654 24.6% 0.9%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 2.00 2.00 0.0000 1.3636 145296.75 145296.75 0.00 53280.80 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.5 75.37% 58284.76 57050 60799 54663.24 0 60799 87858 87858 0.00
crit 0.5 24.63% 116601.39 114100 121599 50187.95 0 121599 57439 57439 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 27671 0.0% 2.0 1.19sec 43887 32011 Direct 2.0 34916 69753 43890 25.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.3714 0.0000 87774.22 129036.41 31.98 32011.02 32011.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.48 74.25% 34916.33 34116 36358 32554.52 0 36358 51851 76225 29.81
crit 0.52 25.75% 69753.45 68232 72716 31209.60 0 72716 35924 52811 14.30
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Meteor Strike 35101 0.0% 1.0 0.00sec 111400 0 Direct 1.0 89632 179619 111409 24.2%  

Stats details: meteor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 111399.72 111399.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.76 75.81% 89631.95 87769 93537 67950.04 0 93537 67950 67950 0.00
crit 0.24 24.19% 179618.83 175538 187075 43449.68 0 187075 43450 43450 0.00
 
 

Action details: meteor_strike

Static Values
  • id:171018
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time>1
Spelldata
  • id:171018
  • name:Meteor Strike
  • school:fire
  • tooltip:Stunned.
  • description:The abyssal releases a powerful burst of flames, dealing {$s1=0} Fire damage to nearby targets, and stunning them for {$d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - doomguard 155526 / 153832
Doom Bolt 155526 11.8% 134.4 2.22sec 344781 155985 Direct 133.7 276287 551312 346773 25.6%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.43 133.67 0.00 0.00 2.2103 0.0000 46350547.02 46350547.02 0.00 155985.24 155985.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.41 74.37% 276286.94 240339 406790 276425.02 266095 288039 27466573 27466573 0.00
crit 34.25 25.63% 551311.99 480678 813580 551635.89 510113 603357 18883974 18883974 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 330070 / 27893
Immolation 206645 1.3% 3.0 0.00sec 1722112 0 Periodic 66.0 62980 125940 78279 24.3% 24.5%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 66.00 66.00 0.0000 1.1194 5166336.40 5166336.40 0.00 69930.65 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.0 75.70% 62979.85 51863 72959 62980.06 58595 68582 3146765 3146765 0.00
crit 16.0 24.30% 125939.81 103727 145918 125930.85 108913 141865 2019572 2019572 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 123425 0.8% 66.0 1.12sec 46754 41768 Direct 66.0 37694 75345 46753 24.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.00 66.00 0.00 0.00 1.1194 0.0000 3085736.44 4536324.86 31.98 41768.00 41768.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.12 75.94% 37693.61 31015 43630 37691.55 35198 40678 1889173 2777264 31.98
crit 15.88 24.06% 75345.24 62029 87260 75364.58 65999 85595 1196563 1759061 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 173563 / 26123
Shadow Bolt 173563 2.0% 3.6 67.47sec 2166029 0 Periodic 36.3 172477 342994 216019 25.5% 16.3%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.62 0.00 36.50 36.27 0.0000 1.3506 7835668.32 7835668.32 0.00 158948.18 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.0 74.46% 172476.65 1278 224492 171961.50 0 216459 4658511 4658511 0.00
crit 9.3 25.54% 342994.46 2555 448983 339706.29 0 448983 3177157 3177157 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 239682 / 71474
Searing Bolt 239682 5.4% 71.3 2.59sec 297544 822363 Direct 70.9 90768 0 90768 0.0%  
Periodic 112.1 105347 209895 131839 25.3% 36.6%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.33 70.93 112.15 112.15 0.3618 0.9847 21223541.40 21223541.40 0.00 155775.97 822362.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.93 100.00% 90767.84 76514 112247 90862.38 82252 112247 6438206 6438206 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.7 74.66% 105346.88 114 157176 105084.56 0 126858 8820394 8820394 0.00
crit 28.4 25.34% 209895.10 857 314352 209619.78 35357 273789 5964942 5964942 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=20 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.070000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 368244 / 21673
Chaos Bolt 368244 1.7% 3.6 67.54sec 1802275 809887 Direct 3.6 0 1813511 1813511 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.63 3.60 0.00 0.00 2.2255 0.0000 6537404.62 6537404.62 0.00 809886.60 809886.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.60 100.00% 1813511.41 1662034 2261471 1813273.98 0 2261471 6537405 6537405 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:8.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 370496 / 23821
Chaos Barrage 370496 1.8% 3.6 66.73sec 1957585 0 Periodic 114.1 49976 99644 62624 25.5% 6.6%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.65 0.00 114.64 114.09 0.0000 0.1731 7144425.29 7144425.29 0.00 359975.07 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.0 74.53% 49975.51 249 61736 49788.02 0 61502 4249532 4249532 0.00
crit 29.1 25.47% 99644.47 846 123473 99308.44 0 123473 2894893 2894893 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
T19 2pc
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 2pc
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.50sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.09 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 14.2 22.98sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.20 0.00 0.00 0.00 1.1168 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target. |cFFFFFFFFGenerates {$s2=3} Soul Shard Fragments.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 2pc
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 2pc
  • harmful:false
  • if_expr:
 
Life Tap 6.8 33.79sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.77 0.00 0.00 0.00 1.1570 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 3.0 121.38sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.soul_harvest.remains
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7766 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Backdraft 33.4 2.0 9.1sec 8.6sec 47.14% 39.96% 0.0(0.0) 1.7

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:15.37%
  • backdraft_2:29.68%
  • backdraft_3:0.69%
  • backdraft_4:1.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Berserking 2.1 0.0 180.5sec 180.5sec 6.90% 10.79% 0.0(0.0) 2.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.4 3.1 35.1sec 25.0sec 32.49% 32.49% 3.1(3.1) 8.1

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagration of Chaos 17.7 0.0 17.0sec 17.0sec 52.25% 48.54% 0.0(0.0) 0.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:52.25%

Trigger Attempt Success

  • trigger_pct:50.02%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a {$h=50}% chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Embrace Chaos 27.6 12.1 11.1sec 7.7sec 45.26% 45.24% 12.1(12.1) 27.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:45.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.2sec 60.2sec 19.17% 19.17% 0.0(0.0) 4.7

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lessons of Space-Time 10.7 3.5 29.1sec 22.9sec 39.28% 39.28% 3.5(3.5) 10.4

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_lessons_of_spacetime
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • lessons_of_spacetime_1:39.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:236176
  • name:Lessons of Space-Time
  • tooltip:You and your minions deal {$s1=10}% increased damage.
  • description:{$@spelldesc236174=While you have a Dimensional Rift open, all of your damage is increased by {$236176s1=10}%.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 99.63% 99.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.2 4.2 22.8sec 17.0sec 30.20% 30.20% 4.2(4.2) 12.9

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.14% 10.14% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.60% 19.60% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 3.0 0.0 121.4sec 121.4sec 13.46% 100.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • soul_harvest_1:13.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.5 68.2sec
flame_rift 3.5 67.3sec
chaos_tear 3.6 67.6sec
chaos_portal 3.6 67.0sec
dimension_ripper 5.0 48.0sec
t19_2pc_chaos_bolt 15.8 18.5sec

Resources

Resource Usage Type Count Total Average RPE APR
T19 2pc
channel_demonfire Mana 27.8 1466117.5 52800.0 90845.6 33.4
chaos_bolt Soul Shard 68.3 136.5 2.0 3.5 726438.9
immolate Mana 29.6 1955017.2 66000.0 113556.4 16.8
incinerate Mana 174.0 9567274.6 55000.0 94628.7 5.8
summon_doomguard Soul Shard 1.7 1.7 1.0 1.7 0.0
pet - doomguard
doom_bolt Energy 134.4 4705.2 35.0 35.0 9851.0
pet - flame_rift
searing_bolt Energy 70.0 70.0 1.0 1.0 303288.8
Resource Gains Type Count Total Average Overflow
life_tap Mana 11.65 3845533.38 (33.48%) 330000.00 0.00 0.00%
immolate Soul Shard 234.25 22.51 (16.59%) 0.10 0.92 3.92%
dimensional_rift Soul Shard 24.43 7.05 (5.20%) 0.29 0.28 3.76%
conflagrate Soul Shard 60.81 29.92 (22.06%) 0.49 0.48 1.59%
incinerate Soul Shard 173.95 34.43 (25.38%) 0.20 0.36 1.03%
mp5_regen Mana 1330.48 7641723.78 (66.52%) 5743.58 115138.93 1.48%
immolate_crits Soul Shard 67.52 6.50 (4.79%) 0.10 0.25 3.75%
soulsnatcher Soul Shard 10.26 10.26 (7.56%) 1.00 0.00 0.00%
feretory_of_souls Soul Shard 21.58 20.55 (15.15%) 0.95 1.04 4.81%
incinerate_crits Soul Shard 44.88 4.43 (3.27%) 0.10 0.06 1.29%
pet - doomguard
energy_regen Energy 231.30 8035.35 (100.00%) 34.74 268.31 3.23%
Resource RPS-Gain RPS-Loss
Health 0.00 10226.38
Mana 22136.62 25029.32
Soul Shard 0.26 0.27
Combat End Resource Mean Min Max
Mana 230218.22 4658.11 470775.06
Soul Shard 1.48 0.00 4.20

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.7%

Statistics & Data Analysis

Fight Length
Sample Data T19 2pc Fight Length
Count 2497
Mean 301.61
Minimum 211.84
Maximum 395.99
Spread ( max - min ) 184.15
Range [ ( max - min ) / 2 * 100% ] 30.53%
Standard Deviation 41.4534
5th Percentile 240.37
95th Percentile 367.82
( 95th Percentile - 5th Percentile ) 127.45
Mean Distribution
Standard Deviation 0.8296
95.00% Confidence Intervall ( 299.98 - 303.24 )
Normalized 95.00% Confidence Intervall ( 99.46% - 100.54% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 726
0.1% Error 72566
0.1 Scale Factor Error with Delta=300 15
0.05 Scale Factor Error with Delta=300 59
0.01 Scale Factor Error with Delta=300 1467
DPS
Sample Data T19 2pc Damage Per Second
Count 2497
Mean 1311547.44
Minimum 1099773.99
Maximum 1554560.22
Spread ( max - min ) 454786.22
Range [ ( max - min ) / 2 * 100% ] 17.34%
Standard Deviation 52881.8920
5th Percentile 1231002.21
95th Percentile 1400856.63
( 95th Percentile - 5th Percentile ) 169854.41
Mean Distribution
Standard Deviation 1058.2730
95.00% Confidence Intervall ( 1309473.27 - 1313621.62 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 63
0.1% Error 6246
0.1 Scale Factor Error with Delta=300 23872486
0.05 Scale Factor Error with Delta=300 95489942
0.01 Scale Factor Error with Delta=300 2387248548
Priority Target DPS
Sample Data T19 2pc Priority Target Damage Per Second
Count 2497
Mean 1311547.44
Minimum 1099773.99
Maximum 1554560.22
Spread ( max - min ) 454786.22
Range [ ( max - min ) / 2 * 100% ] 17.34%
Standard Deviation 52881.8920
5th Percentile 1231002.21
95th Percentile 1400856.63
( 95th Percentile - 5th Percentile ) 169854.41
Mean Distribution
Standard Deviation 1058.2730
95.00% Confidence Intervall ( 1309473.27 - 1313621.62 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 63
0.1% Error 6246
0.1 Scale Factor Error with Delta=300 23872486
0.05 Scale Factor Error with Delta=300 95489942
0.01 Scale Factor Error with Delta=300 2387248548
DPS(e)
Sample Data T19 2pc Damage Per Second (Effective)
Count 2497
Mean 1311547.44
Minimum 1099773.99
Maximum 1554560.22
Spread ( max - min ) 454786.22
Range [ ( max - min ) / 2 * 100% ] 17.34%
Damage
Sample Data T19 2pc Damage
Count 2497
Mean 297355440.24
Minimum 219254499.13
Maximum 373427678.75
Spread ( max - min ) 154173179.62
Range [ ( max - min ) / 2 * 100% ] 25.92%
DTPS
Sample Data T19 2pc Damage Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T19 2pc Healing Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T19 2pc Healing Per Second (Effective)
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T19 2pc Heal
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T19 2pc Healing Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T19 2pc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data T19 2pcTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T19 2pc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
0.00 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
C 1.12 dimensional_rift,if=charges=3
0.00 cataclysm,if=spell_targets.cataclysm>=3
D 5.25 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
0.00 immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
E 2.09 berserking
0.00 blood_fury
F 8.10 use_items
G 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
H 18.20 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
I 0.21 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
J 1.16 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
0.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
K 1.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
L 2.98 soul_harvest,if=!buff.soul_harvest.remains
0.00 chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
M 16.14 channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
0.00 rain_of_fire,if=active_enemies>=3
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
N 11.92 dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
O 1.78 chaos_bolt,if=active_enemies<3&target.time_to_die<=10
P 37.04 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
0.00 shadowburn
Q 16.94 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
R 12.03 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
S 101.45 incinerate
T 6.77 life_tap

Sample Sequence

0136ABCDEFHHKLMNPPQSNPSSSHRSMPSFQPSSPSSQPSSRMSQSSSSSSHCNPPSMDHPSSSSQSSSNRSHMPPSSPFQSSSTRSHNMSSSPHSSRSSHPSPMTSHSSFPJDLGPQSPSSMPQSRFSSSHPSSTSMHPRSSSQSSSSSPMQPRTNESHSSSSSSQMPRSSSQFTPSSSSQMPDSSHSSPSNPPQMDSPQSSTFSSSHJLPMDPHPSSPSFSSQRSSNTMPQSPSSQSRSOSSMOQS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T19 2pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food T19 2pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_infernal Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation T19 2pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, potion_of_prolonged_power
0:00.000 default C dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, potion_of_prolonged_power
0:01.170 default D immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.3/5: 26% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:02.072 default E berserking Fluffy_Pillow 1034073.4/1100000: 94% mana | 1.3/5: 26% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:02.072 default F use_items Fluffy_Pillow 1034073.4/1100000: 94% mana | 1.3/5: 26% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:02.072 default H conflagrate Fluffy_Pillow 1034073.4/1100000: 94% mana | 1.3/5: 26% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:02.857 default H conflagrate Fluffy_Pillow 1050645.2/1100000: 96% mana | 2.8/5: 56% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:03.642 default K summon_doomguard Fluffy_Pillow 1067217.0/1100000: 97% mana | 3.3/5: 66% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:04.427 default L soul_harvest Fluffy_Pillow 1083788.8/1100000: 99% mana | 2.4/5: 48% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:04.427 default M channel_demonfire Fluffy_Pillow 1083788.8/1100000: 99% mana | 2.4/5: 48% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:06.243 default N dimensional_rift Fluffy_Pillow 1069325.6/1100000: 97% mana | 2.6/5: 52% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:07.029 default P chaos_bolt Fluffy_Pillow 1085918.5/1100000: 99% mana | 3.1/5: 62% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:08.125 default P chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.1/5: 42% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:09.065 default Q conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.2/5: 24% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:09.847 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.7/5: 34% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:10.600 default N dimensional_rift Fluffy_Pillow 1046752.2/1100000: 95% mana | 2.1/5: 42% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:11.388 default P chaos_bolt Fluffy_Pillow 1063387.3/1100000: 97% mana | 2.4/5: 48% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:12.142 default S incinerate Fluffy_Pillow 1079111.9/1100000: 98% mana | 0.5/5: 10% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:13.250 default S incinerate Fluffy_Pillow 1044451.5/1100000: 95% mana | 0.8/5: 16% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:14.358 default S incinerate Fluffy_Pillow 1009791.0/1100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:15.463 default H conflagrate Fluffy_Pillow 975075.5/1100000: 89% mana | 1.3/5: 26% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:16.367 default R immolate Fluffy_Pillow 991670.3/1100000: 90% mana | 1.8/5: 36% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:17.270 default S incinerate Fluffy_Pillow 942246.6/1100000: 86% mana | 1.9/5: 38% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.047 default M channel_demonfire Fluffy_Pillow 901512.3/1100000: 82% mana | 2.2/5: 44% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:20.148 default P chaos_bolt Fluffy_Pillow 888081.6/1100000: 81% mana | 2.3/5: 46% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:21.382 default S incinerate Fluffy_Pillow 911204.7/1100000: 83% mana | 0.4/5: 8% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:22.466 default F use_items Fluffy_Pillow 876517.0/1100000: 80% mana | 1.7/5: 34% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:22.466 default Q conflagrate Fluffy_Pillow 876517.0/1100000: 80% mana | 1.7/5: 34% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:23.350 default P chaos_bolt Fluffy_Pillow 893081.7/1100000: 81% mana | 2.2/5: 44% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:24.106 default S incinerate Fluffy_Pillow 907223.1/1100000: 82% mana | 1.3/5: 26% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.881 default S incinerate Fluffy_Pillow 866449.8/1100000: 79% mana | 1.5/5: 30% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:25.988 default P chaos_bolt Fluffy_Pillow 831771.0/1100000: 76% mana | 2.8/5: 56% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:27.069 default S incinerate Fluffy_Pillow 851614.9/1100000: 77% mana | 0.8/5: 16% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.175 default S incinerate Fluffy_Pillow 816917.8/1100000: 74% mana | 1.2/5: 24% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.283 default Q conflagrate Fluffy_Pillow 782257.3/1100000: 71% mana | 1.5/5: 30% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.187 default P chaos_bolt Fluffy_Pillow 798852.1/1100000: 73% mana | 2.0/5: 40% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.946 default S incinerate Fluffy_Pillow 812786.9/1100000: 74% mana | 0.0/5: 0% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:31.707 default S incinerate Fluffy_Pillow 772046.8/1100000: 70% mana | 0.4/5: 8% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:32.792 default R immolate Fluffy_Pillow 737377.9/1100000: 67% mana | 0.6/5: 12% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:33.675 default M channel_demonfire Fluffy_Pillow 687923.9/1100000: 63% mana | 0.8/5: 16% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:35.578 default S incinerate Fluffy_Pillow 670782.9/1100000: 61% mana | 1.0/5: 20% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.663 default Q conflagrate Fluffy_Pillow 636114.0/1100000: 58% mana | 1.3/5: 26% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:37.546 default S incinerate Fluffy_Pillow 652429.3/1100000: 59% mana | 1.8/5: 36% soul_shard bloodlust, backdraft(2), lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:38.321 default S incinerate Fluffy_Pillow 611655.9/1100000: 56% mana | 2.1/5: 42% soul_shard bloodlust, backdraft, lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:39.096 default S incinerate Fluffy_Pillow 570882.6/1100000: 52% mana | 2.3/5: 46% soul_shard bloodlust, lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:40.203 default S incinerate Fluffy_Pillow 536203.8/1100000: 49% mana | 2.8/5: 56% soul_shard bloodlust, lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:41.308 default S incinerate Fluffy_Pillow 496807.3/1100000: 45% mana | 3.1/5: 62% soul_shard lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:42.746 default S incinerate Fluffy_Pillow 462113.0/1100000: 42% mana | 3.4/5: 68% soul_shard lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:44.183 default H conflagrate Fluffy_Pillow 427404.5/1100000: 39% mana | 3.9/5: 78% soul_shard lord_of_flames, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:45.371 default C dimensional_rift Fluffy_Pillow 444180.0/1100000: 40% mana | 4.4/5: 88% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:46.542 default N dimensional_rift Fluffy_Pillow 460763.2/1100000: 42% mana | 4.8/5: 96% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:47.691 default P chaos_bolt Fluffy_Pillow 477325.0/1100000: 43% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:49.298 default P chaos_bolt Fluffy_Pillow 500488.5/1100000: 45% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:50.264 default S incinerate Fluffy_Pillow 514412.5/1100000: 47% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:51.673 default M channel_demonfire Fluffy_Pillow 479722.0/1100000: 44% mana | 1.3/5: 26% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:54.277 default D immolate Fluffy_Pillow 464456.3/1100000: 42% mana | 1.4/5: 28% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:55.426 default H conflagrate Fluffy_Pillow 415018.2/1100000: 38% mana | 1.4/5: 28% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:56.575 default P chaos_bolt Fluffy_Pillow 431580.0/1100000: 39% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.182 default S incinerate Fluffy_Pillow 454683.3/1100000: 41% mana | 0.2/5: 4% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
0:59.190 default S incinerate Fluffy_Pillow 413917.0/1100000: 38% mana | 0.4/5: 8% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:00.628 default S incinerate Fluffy_Pillow 379222.7/1100000: 34% mana | 0.7/5: 14% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:02.068 default S incinerate Fluffy_Pillow 344556.6/1100000: 31% mana | 0.9/5: 18% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:03.507 default Q conflagrate Fluffy_Pillow 309876.4/1100000: 28% mana | 1.3/5: 26% soul_shard lord_of_flames, conflagration_of_chaos
1:04.679 default S incinerate Fluffy_Pillow 326426.0/1100000: 30% mana | 1.8/5: 36% soul_shard backdraft(2), lord_of_flames
1:05.686 default S incinerate Fluffy_Pillow 285645.6/1100000: 26% mana | 2.1/5: 42% soul_shard backdraft, lord_of_flames
1:06.691 default S incinerate Fluffy_Pillow 244837.0/1100000: 22% mana | 2.4/5: 48% soul_shard lord_of_flames
1:08.130 default N dimensional_rift Fluffy_Pillow 210156.7/1100000: 19% mana | 2.8/5: 56% soul_shard lord_of_flames
1:09.302 default R immolate Fluffy_Pillow 226706.3/1100000: 21% mana | 3.1/5: 62% soul_shard lessons_of_spacetime, lord_of_flames
1:10.473 default S incinerate Fluffy_Pillow 177241.7/1100000: 16% mana | 3.2/5: 64% soul_shard lessons_of_spacetime, lord_of_flames
1:11.911 default H conflagrate Fluffy_Pillow 142547.4/1100000: 13% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, lord_of_flames
1:13.171 default M channel_demonfire Fluffy_Pillow 160339.6/1100000: 15% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos
1:15.759 default P chaos_bolt Fluffy_Pillow 144084.1/1100000: 13% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
1:17.397 default P chaos_bolt Fluffy_Pillow 167214.8/1100000: 15% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:18.362 default S incinerate Fluffy_Pillow 181124.4/1100000: 16% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:19.771 default S incinerate Fluffy_Pillow 146433.9/1100000: 13% mana | 1.4/5: 28% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:21.180 default P chaos_bolt Fluffy_Pillow 111743.4/1100000: 10% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:22.559 default F use_items Fluffy_Pillow 131620.5/1100000: 12% mana | 0.7/5: 14% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:22.559 default Q conflagrate Fluffy_Pillow 131620.5/1100000: 12% mana | 0.7/5: 14% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:23.708 default S incinerate Fluffy_Pillow 148090.2/1100000: 13% mana | 1.3/5: 26% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos
1:24.714 default S incinerate Fluffy_Pillow 107295.7/1100000: 10% mana | 1.5/5: 30% soul_shard backdraft, lord_of_flames, embrace_chaos
1:25.722 default S incinerate Fluffy_Pillow 66529.4/1100000: 6% mana | 1.7/5: 34% soul_shard lord_of_flames, embrace_chaos
1:27.160 default T life_tap Fluffy_Pillow 31835.1/1100000: 3% mana | 2.0/5: 40% soul_shard lord_of_flames
1:28.332 default R immolate Fluffy_Pillow 378384.6/1100000: 34% mana | 2.2/5: 44% soul_shard lord_of_flames
1:29.506 default S incinerate Fluffy_Pillow 328962.4/1100000: 30% mana | 2.2/5: 44% soul_shard lord_of_flames
1:30.944 default H conflagrate Fluffy_Pillow 294268.1/1100000: 27% mana | 2.5/5: 50% soul_shard lord_of_flames
1:32.117 default N dimensional_rift Fluffy_Pillow 310831.7/1100000: 28% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames
1:33.289 default M channel_demonfire Fluffy_Pillow 327381.3/1100000: 30% mana | 3.4/5: 68% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
1:35.855 default S incinerate Fluffy_Pillow 311295.1/1100000: 28% mana | 3.6/5: 72% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, extracted_sanity, mark_of_the_claw
1:36.842 default S incinerate Fluffy_Pillow 270521.8/1100000: 25% mana | 3.8/5: 76% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, extracted_sanity, mark_of_the_claw
1:37.828 default S incinerate Fluffy_Pillow 229734.1/1100000: 21% mana | 4.3/5: 86% soul_shard lessons_of_spacetime, lord_of_flames, extracted_sanity, mark_of_the_claw
1:39.235 default P chaos_bolt Fluffy_Pillow 195014.8/1100000: 18% mana | 4.5/5: 90% soul_shard lessons_of_spacetime, lord_of_flames, extracted_sanity, mark_of_the_claw
1:41.530 default H conflagrate Fluffy_Pillow 227710.6/1100000: 21% mana | 2.6/5: 52% soul_shard lord_of_flames, embrace_chaos, extracted_sanity
1:42.702 default S incinerate Fluffy_Pillow 244260.1/1100000: 22% mana | 3.3/5: 66% soul_shard backdraft(2), lord_of_flames, embrace_chaos, extracted_sanity
1:43.710 default S incinerate Fluffy_Pillow 203493.9/1100000: 18% mana | 3.5/5: 70% soul_shard backdraft, lord_of_flames, embrace_chaos, extracted_sanity
1:44.717 default R immolate Fluffy_Pillow 162713.5/1100000: 15% mana | 3.9/5: 78% soul_shard lord_of_flames, embrace_chaos, extracted_sanity
1:45.888 default S incinerate Fluffy_Pillow 113248.9/1100000: 10% mana | 3.9/5: 78% soul_shard lord_of_flames, extracted_sanity
1:47.325 default S incinerate Fluffy_Pillow 78540.5/1100000: 7% mana | 4.3/5: 86% soul_shard lord_of_flames
1:48.761 default H conflagrate Fluffy_Pillow 43817.9/1100000: 4% mana | 4.6/5: 92% soul_shard lord_of_flames
1:50.129 default P chaos_bolt Fluffy_Pillow 63135.1/1100000: 6% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames
1:51.768 default S incinerate Fluffy_Pillow 86411.3/1100000: 8% mana | 4.0/5: 80% soul_shard backdraft, lord_of_flames, embrace_chaos, mark_of_the_claw
1:52.754 default P chaos_bolt Fluffy_Pillow 45623.7/1100000: 4% mana | 5.0/5: 100% soul_shard lord_of_flames, embrace_chaos, mark_of_the_claw
1:54.130 default M channel_demonfire Fluffy_Pillow 65457.5/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, mark_of_the_claw
1:56.533 default T life_tap Fluffy_Pillow 47294.6/1100000: 4% mana | 3.2/5: 64% soul_shard lord_of_flames, embrace_chaos, mark_of_the_claw
1:57.682 default S incinerate Fluffy_Pillow 393749.3/1100000: 36% mana | 3.2/5: 64% soul_shard lord_of_flames, embrace_chaos
1:59.120 default H conflagrate Fluffy_Pillow 359055.0/1100000: 33% mana | 3.6/5: 72% soul_shard lord_of_flames
2:00.292 default S incinerate Fluffy_Pillow 375604.5/1100000: 34% mana | 4.1/5: 82% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
2:01.299 default S incinerate Fluffy_Pillow 334824.1/1100000: 30% mana | 4.4/5: 88% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:02.306 default F use_items Fluffy_Pillow 294043.8/1100000: 27% mana | 4.7/5: 94% soul_shard lord_of_flames, conflagration_of_chaos
2:02.306 default P chaos_bolt Fluffy_Pillow 294043.8/1100000: 27% mana | 4.7/5: 94% soul_shard lord_of_flames, conflagration_of_chaos
2:04.646 default J dimensional_rift Fluffy_Pillow 327086.4/1100000: 30% mana | 2.9/5: 58% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:05.819 default D immolate Fluffy_Pillow 343650.0/1100000: 31% mana | 3.4/5: 68% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:06.993 default L soul_harvest Fluffy_Pillow 294227.8/1100000: 27% mana | 3.4/5: 68% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:06.993 default G potion Fluffy_Pillow 294227.8/1100000: 27% mana | 3.4/5: 68% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:06.993 default P chaos_bolt Fluffy_Pillow 294227.8/1100000: 27% mana | 3.4/5: 68% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:08.399 default Q conflagrate Fluffy_Pillow 314081.6/1100000: 29% mana | 1.5/5: 30% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:09.571 default S incinerate Fluffy_Pillow 330631.2/1100000: 30% mana | 2.0/5: 40% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:10.577 default P chaos_bolt Fluffy_Pillow 289836.7/1100000: 26% mana | 3.3/5: 66% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:11.562 default S incinerate Fluffy_Pillow 303745.6/1100000: 28% mana | 1.3/5: 26% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:12.999 default S incinerate Fluffy_Pillow 269037.2/1100000: 24% mana | 1.6/5: 32% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:14.439 default M channel_demonfire Fluffy_Pillow 234371.1/1100000: 21% mana | 1.8/5: 36% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:17.020 default P chaos_bolt Fluffy_Pillow 218016.8/1100000: 20% mana | 2.1/5: 42% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:19.359 default Q conflagrate Fluffy_Pillow 251045.3/1100000: 23% mana | 0.3/5: 6% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:20.532 default S incinerate Fluffy_Pillow 267609.0/1100000: 24% mana | 0.8/5: 16% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:21.539 default R immolate Fluffy_Pillow 226828.6/1100000: 21% mana | 1.0/5: 20% soul_shard backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:22.712 default F use_items Fluffy_Pillow 177392.3/1100000: 16% mana | 1.1/5: 22% soul_shard backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:22.712 default S incinerate Fluffy_Pillow 177392.3/1100000: 16% mana | 1.1/5: 22% soul_shard backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:23.721 default S incinerate Fluffy_Pillow 136640.1/1100000: 12% mana | 1.3/5: 26% soul_shard lord_of_flames, concordance_of_the_legionfall, potion_of_deadly_grace
2:25.159 default S incinerate Fluffy_Pillow 101945.8/1100000: 9% mana | 1.8/5: 36% soul_shard lord_of_flames, concordance_of_the_legionfall, potion_of_deadly_grace
2:26.596 default H conflagrate Fluffy_Pillow 67238.5/1100000: 6% mana | 2.1/5: 42% soul_shard lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:27.746 default P chaos_bolt Fluffy_Pillow 83814.7/1100000: 8% mana | 2.6/5: 52% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:29.351 default S incinerate Fluffy_Pillow 106949.4/1100000: 10% mana | 0.7/5: 14% soul_shard backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:30.337 default S incinerate Fluffy_Pillow 66161.7/1100000: 6% mana | 0.9/5: 18% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:31.746 default T life_tap Fluffy_Pillow 31471.2/1100000: 3% mana | 1.2/5: 24% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:32.896 default S incinerate Fluffy_Pillow 377958.2/1100000: 34% mana | 1.2/5: 24% soul_shard lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:34.333 default M channel_demonfire Fluffy_Pillow 343249.8/1100000: 31% mana | 1.6/5: 32% soul_shard lord_of_flames, potion_of_deadly_grace
2:36.961 default H conflagrate Fluffy_Pillow 327559.2/1100000: 30% mana | 1.8/5: 36% soul_shard lord_of_flames, concordance_of_the_legionfall, extracted_sanity, potion_of_deadly_grace
2:38.134 default P chaos_bolt Fluffy_Pillow 344122.8/1100000: 31% mana | 2.4/5: 48% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
2:39.773 default R immolate Fluffy_Pillow 367266.8/1100000: 33% mana | 0.4/5: 8% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
2:40.946 default S incinerate Fluffy_Pillow 317830.4/1100000: 29% mana | 0.5/5: 10% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
2:41.954 default S incinerate Fluffy_Pillow 277064.2/1100000: 25% mana | 0.7/5: 14% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
2:43.392 default S incinerate Fluffy_Pillow 242625.4/1100000: 22% mana | 1.1/5: 22% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:44.800 default Q conflagrate Fluffy_Pillow 207920.4/1100000: 19% mana | 1.4/5: 28% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:46.069 default S incinerate Fluffy_Pillow 226211.9/1100000: 21% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:47.056 default S incinerate Fluffy_Pillow 185438.6/1100000: 17% mana | 2.3/5: 46% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
2:48.043 default S incinerate Fluffy_Pillow 144665.4/1100000: 13% mana | 2.6/5: 52% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
2:49.453 default S incinerate Fluffy_Pillow 109989.3/1100000: 10% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
2:50.862 default S incinerate Fluffy_Pillow 75298.7/1100000: 7% mana | 3.3/5: 66% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
2:52.270 default P chaos_bolt Fluffy_Pillow 40593.8/1100000: 4% mana | 3.7/5: 74% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
2:54.562 default M channel_demonfire Fluffy_Pillow 73478.1/1100000: 7% mana | 1.8/5: 36% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
2:57.093 default Q conflagrate Fluffy_Pillow 57160.2/1100000: 5% mana | 1.9/5: 38% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
2:58.242 default P chaos_bolt Fluffy_Pillow 73722.0/1100000: 7% mana | 2.4/5: 48% soul_shard backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
2:59.207 default R immolate Fluffy_Pillow 87631.6/1100000: 8% mana | 1.5/5: 30% soul_shard backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:00.356 default T life_tap Fluffy_Pillow 38193.4/1100000: 3% mana | 1.5/5: 30% soul_shard backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:01.504 default N dimensional_rift Fluffy_Pillow 384463.6/1100000: 35% mana | 1.6/5: 32% soul_shard backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall
3:02.676 default E berserking Fluffy_Pillow 401013.2/1100000: 36% mana | 1.9/5: 38% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos
3:02.676 default S incinerate Fluffy_Pillow 401013.2/1100000: 36% mana | 1.9/5: 38% soul_shard berserking, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos
3:03.553 default H conflagrate Fluffy_Pillow 360254.7/1100000: 33% mana | 2.2/5: 44% soul_shard berserking, lessons_of_spacetime, lord_of_flames
3:04.574 default S incinerate Fluffy_Pillow 376834.6/1100000: 34% mana | 2.7/5: 54% soul_shard berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos
3:05.450 default S incinerate Fluffy_Pillow 336128.0/1100000: 31% mana | 3.0/5: 60% soul_shard berserking, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:06.307 default S incinerate Fluffy_Pillow 295333.8/1100000: 27% mana | 3.2/5: 64% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:07.532 default S incinerate Fluffy_Pillow 260639.7/1100000: 24% mana | 3.5/5: 70% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:08.756 default S incinerate Fluffy_Pillow 225929.0/1100000: 21% mana | 3.7/5: 74% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:09.983 default S incinerate Fluffy_Pillow 191268.0/1100000: 17% mana | 4.1/5: 82% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:11.209 default Q conflagrate Fluffy_Pillow 156590.5/1100000: 14% mana | 4.3/5: 86% soul_shard berserking, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:12.400 default M channel_demonfire Fluffy_Pillow 175944.1/1100000: 16% mana | 4.9/5: 98% soul_shard berserking, backdraft(2), lord_of_flames, conflagration_of_chaos
3:14.745 default P chaos_bolt Fluffy_Pillow 157015.0/1100000: 14% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:16.350 default R immolate Fluffy_Pillow 180149.7/1100000: 16% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:17.499 default S incinerate Fluffy_Pillow 130711.5/1100000: 12% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:18.486 default S incinerate Fluffy_Pillow 89938.2/1100000: 8% mana | 3.4/5: 68% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:19.893 default S incinerate Fluffy_Pillow 55218.8/1100000: 5% mana | 3.6/5: 72% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:21.303 default Q conflagrate Fluffy_Pillow 20206.0/1100000: 2% mana | 3.9/5: 78% soul_shard lord_of_flames, conflagration_of_chaos
3:22.475 default F use_items Fluffy_Pillow 36755.5/1100000: 3% mana | 4.4/5: 88% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:22.475 default T life_tap Fluffy_Pillow 36755.5/1100000: 3% mana | 4.4/5: 88% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:23.646 default P chaos_bolt Fluffy_Pillow 383290.9/1100000: 35% mana | 4.5/5: 90% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:25.286 default S incinerate Fluffy_Pillow 406449.0/1100000: 37% mana | 2.7/5: 54% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:26.294 default S incinerate Fluffy_Pillow 365682.8/1100000: 33% mana | 2.9/5: 58% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:27.734 default S incinerate Fluffy_Pillow 331016.7/1100000: 30% mana | 3.2/5: 64% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:29.172 default S incinerate Fluffy_Pillow 296322.3/1100000: 27% mana | 3.5/5: 70% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:30.611 default Q conflagrate Fluffy_Pillow 261642.1/1100000: 24% mana | 3.9/5: 78% soul_shard lord_of_flames, conflagration_of_chaos
3:31.783 default M channel_demonfire Fluffy_Pillow 278191.7/1100000: 25% mana | 4.4/5: 88% soul_shard backdraft(2), lord_of_flames
3:34.436 default P chaos_bolt Fluffy_Pillow 262854.1/1100000: 24% mana | 4.8/5: 96% soul_shard backdraft(2), lord_of_flames
3:36.076 default D immolate Fluffy_Pillow 286012.2/1100000: 26% mana | 2.8/5: 56% soul_shard backdraft, lord_of_flames, embrace_chaos, extracted_sanity
3:37.250 default S incinerate Fluffy_Pillow 236589.9/1100000: 22% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, embrace_chaos, extracted_sanity
3:38.257 default S incinerate Fluffy_Pillow 195809.6/1100000: 18% mana | 3.3/5: 66% soul_shard lord_of_flames, embrace_chaos, extracted_sanity
3:39.695 default H conflagrate Fluffy_Pillow 161115.2/1100000: 15% mana | 3.6/5: 72% soul_shard lord_of_flames, embrace_chaos, extracted_sanity
3:40.867 default S incinerate Fluffy_Pillow 177664.8/1100000: 16% mana | 4.2/5: 84% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity
3:41.874 default S incinerate Fluffy_Pillow 136884.4/1100000: 12% mana | 4.5/5: 90% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
3:42.881 default P chaos_bolt Fluffy_Pillow 96104.0/1100000: 9% mana | 4.8/5: 96% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
3:45.222 default S incinerate Fluffy_Pillow 129160.8/1100000: 12% mana | 2.9/5: 58% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
3:46.661 default N dimensional_rift Fluffy_Pillow 94480.5/1100000: 9% mana | 3.1/5: 62% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:47.835 default P chaos_bolt Fluffy_Pillow 111058.3/1100000: 10% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:49.242 default P chaos_bolt Fluffy_Pillow 130926.3/1100000: 12% mana | 2.5/5: 50% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:50.648 default Q conflagrate Fluffy_Pillow 150780.1/1100000: 14% mana | 1.6/5: 32% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:51.821 default M channel_demonfire Fluffy_Pillow 167343.7/1100000: 15% mana | 3.1/5: 62% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:54.436 default D immolate Fluffy_Pillow 151469.6/1100000: 14% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:55.611 default S incinerate Fluffy_Pillow 102061.5/1100000: 9% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:56.618 default P chaos_bolt Fluffy_Pillow 61281.1/1100000: 6% mana | 4.7/5: 94% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:58.257 default Q conflagrate Fluffy_Pillow 84425.0/1100000: 8% mana | 2.7/5: 54% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:59.429 default S incinerate Fluffy_Pillow 100974.6/1100000: 9% mana | 3.3/5: 66% soul_shard backdraft(2), lord_of_flames, embrace_chaos
4:00.437 default S incinerate Fluffy_Pillow 60209.8/1100000: 5% mana | 3.5/5: 70% soul_shard backdraft, lord_of_flames, embrace_chaos, mark_of_the_claw
4:01.425 default T life_tap Fluffy_Pillow 19450.9/1100000: 2% mana | 3.8/5: 76% soul_shard lord_of_flames, embrace_chaos, mark_of_the_claw
4:02.575 default F use_items Fluffy_Pillow 366027.1/1100000: 33% mana | 3.8/5: 76% soul_shard lord_of_flames, mark_of_the_claw
4:02.575 default S incinerate Fluffy_Pillow 366027.1/1100000: 33% mana | 3.8/5: 76% soul_shard lord_of_flames, mark_of_the_claw
4:03.983 default S incinerate Fluffy_Pillow 331322.2/1100000: 30% mana | 4.2/5: 84% soul_shard lord_of_flames, mark_of_the_claw
4:05.391 default S incinerate Fluffy_Pillow 296617.3/1100000: 27% mana | 4.5/5: 90% soul_shard lord_of_flames, mark_of_the_claw
4:06.801 default H conflagrate Fluffy_Pillow 261832.9/1100000: 24% mana | 4.7/5: 94% soul_shard lord_of_flames
4:08.190 default J dimensional_rift Fluffy_Pillow 281446.7/1100000: 26% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames
4:09.362 default L soul_harvest Fluffy_Pillow 297996.2/1100000: 27% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
4:09.362 default P chaos_bolt Fluffy_Pillow 297996.2/1100000: 27% mana | 5.0/5: 100% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames
4:11.002 default M channel_demonfire Fluffy_Pillow 321154.3/1100000: 29% mana | 3.0/5: 60% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos
4:13.714 default D immolate Fluffy_Pillow 306649.8/1100000: 28% mana | 3.1/5: 62% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos
4:14.887 default P chaos_bolt Fluffy_Pillow 257213.5/1100000: 23% mana | 4.2/5: 84% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos
4:16.292 default H conflagrate Fluffy_Pillow 277053.2/1100000: 25% mana | 2.2/5: 44% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos
4:17.537 default P chaos_bolt Fluffy_Pillow 294633.5/1100000: 27% mana | 2.9/5: 58% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
4:18.524 default S incinerate Fluffy_Pillow 308570.7/1100000: 28% mana | 0.9/5: 18% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:19.531 default S incinerate Fluffy_Pillow 267790.4/1100000: 24% mana | 1.1/5: 22% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:20.968 default P chaos_bolt Fluffy_Pillow 233081.9/1100000: 21% mana | 2.6/5: 52% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:22.373 default S incinerate Fluffy_Pillow 252921.6/1100000: 23% mana | 0.8/5: 16% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:23.811 default F use_items Fluffy_Pillow 218227.3/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:23.811 default S incinerate Fluffy_Pillow 218227.3/1100000: 20% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:25.249 default S incinerate Fluffy_Pillow 183532.9/1100000: 17% mana | 1.3/5: 26% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:26.688 default Q conflagrate Fluffy_Pillow 148852.7/1100000: 14% mana | 1.6/5: 32% soul_shard lord_of_flames, conflagration_of_chaos
4:27.860 default R immolate Fluffy_Pillow 165402.3/1100000: 15% mana | 2.1/5: 42% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
4:29.032 default S incinerate Fluffy_Pillow 115951.8/1100000: 11% mana | 2.2/5: 44% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
4:30.040 default S incinerate Fluffy_Pillow 75185.6/1100000: 7% mana | 2.4/5: 48% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
4:31.046 default N dimensional_rift Fluffy_Pillow 34391.1/1100000: 3% mana | 2.6/5: 52% soul_shard lord_of_flames, conflagration_of_chaos
4:32.219 default T life_tap Fluffy_Pillow 50954.7/1100000: 5% mana | 3.1/5: 62% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
4:33.390 default M channel_demonfire Fluffy_Pillow 397490.2/1100000: 36% mana | 3.1/5: 62% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
4:35.889 default P chaos_bolt Fluffy_Pillow 380665.5/1100000: 35% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:38.182 default Q conflagrate Fluffy_Pillow 413717.1/1100000: 38% mana | 1.4/5: 28% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:39.331 default S incinerate Fluffy_Pillow 430278.9/1100000: 39% mana | 1.9/5: 38% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:40.316 default P chaos_bolt Fluffy_Pillow 389250.6/1100000: 35% mana | 2.2/5: 44% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
4:41.301 default S incinerate Fluffy_Pillow 403159.6/1100000: 37% mana | 0.3/5: 6% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
4:42.739 default S incinerate Fluffy_Pillow 368465.3/1100000: 33% mana | 0.5/5: 10% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
4:44.179 default Q conflagrate Fluffy_Pillow 333801.2/1100000: 30% mana | 1.8/5: 36% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, mark_of_the_claw
4:45.424 default S incinerate Fluffy_Pillow 351746.8/1100000: 32% mana | 2.5/5: 50% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
4:46.411 default R immolate Fluffy_Pillow 310973.5/1100000: 28% mana | 2.8/5: 56% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
4:47.560 default S incinerate Fluffy_Pillow 261535.3/1100000: 24% mana | 2.9/5: 58% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
4:48.547 default O chaos_bolt Fluffy_Pillow 220762.1/1100000: 20% mana | 3.1/5: 62% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
4:50.841 default S incinerate Fluffy_Pillow 253631.8/1100000: 23% mana | 1.2/5: 24% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:52.281 default S incinerate Fluffy_Pillow 218965.7/1100000: 20% mana | 1.7/5: 34% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:53.719 default M channel_demonfire Fluffy_Pillow 184271.4/1100000: 17% mana | 1.9/5: 38% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:56.336 default O chaos_bolt Fluffy_Pillow 168425.4/1100000: 15% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos
4:58.677 default Q conflagrate Fluffy_Pillow 201483.6/1100000: 18% mana | 1.1/5: 22% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
4:59.827 default S incinerate Fluffy_Pillow 218059.8/1100000: 20% mana | 1.8/5: 36% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 75895 75895 46630
Intellect 61279 59573 49413 (4609)
Spirit 1 1 0
Health 4553700 4553700 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 61279 59573 0
Crit 23.42% 23.42% 7369
Haste 28.37% 27.37% 10264
Damage / Heal Versatility 8.10% 8.10% 3849
ManaReg per Second 14121 14011 0
Mastery 49.40% 49.40% 6681
Armor 2233 2233 2233
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 938.00
Local Head Diabolic Helm
ilevel: 930, stats: { 281 Armor, +4305 Sta, +2870 Int, +1082 Crit, +766 Mastery }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Lessons of Space-Time
ilevel: 970, stats: { 300 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Chest Diabolic Robe
ilevel: 930, stats: { 346 Armor, +4305 Sta, +2870 Int, +1241 Haste, +607 Vers }
Local Waist Feretory of Souls
ilevel: 970, stats: { 225 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Legs Diabolic Leggings
ilevel: 930, stats: { 303 Armor, +4305 Sta, +2870 Int, +1162 Mastery, +686 Haste }
Local Feet Slippers of Enduring Vigilance
ilevel: 930, stats: { 238 Armor, +3229 Sta, +2153 Int, +931 Haste, +455 Mastery }
Local Wrists Oathbreaker's Cuffs
ilevel: 930, stats: { 151 Armor, +2422 Sta, +1615 Int, +676 Crit, +364 Vers }
Local Hands Gloves of Furtive Oppression
ilevel: 930, stats: { 216 Armor, +3229 Sta, +2153 Int, +812 Crit, +574 Mastery }
Local Finger1 Yathae's Thumb Ring
ilevel: 930, stats: { +2422 Sta, +2414 Crit, +1106 Vers }, enchant: { +200 Haste }
Local Finger2 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Diabolic Shroud
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +676 Crit, +364 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 957, weapon: { 9093 - 13641, 3.6 }, stats: { +3691 Int, +5537 Sta, +1024 Haste, +1024 Mastery, +20134 Int }, relics: { +55 ilevels, +55 ilevels, +55 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="T19 2pc"
spec=destruction
level=110
race=troll
role=spell
position=back
talents=1203012
artifact=38:0:0:0:0:803:1:804:4:805:4:806:4:807:4:808:4:809:4:810:4:811:4:812:4:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1612:1:1713:1

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
actions+=/havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/cataclysm,if=spell_targets.cataclysm>=3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
actions+=/immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/use_items
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest,if=!buff.soul_harvest.remains
actions+=/chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
actions+=/rain_of_fire,if=active_enemies>=3
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=active_enemies<3&target.time_to_die<=10
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=diabolic_helm,id=147183,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant_id=5437
shoulders=lessons_of_spacetime,id=144369,ilevel=970
back=diabolic_shroud,id=147181,ilevel=930,enchant_id=5436
chest=diabolic_robe,id=147185,ilevel=930
wrists=oathbreakers_cuffs,id=147001,ilevel=930
hands=gloves_of_furtive_oppression,id=146988,ilevel=930
waist=feretory_of_souls,id=132456,ilevel=970
legs=diabolic_leggings,id=147184,ilevel=930
feet=slippers_of_enduring_vigilance,id=146987,ilevel=930
finger1=yathaes_thumb_ring,id=147021,ilevel=930,enchant_id=5428
finger2=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant_id=5428
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=scepter_of_sargeras,id=128941,ilevel=957,gem_id=147087/147090/147087

# Gear Summary
# gear_ilvl=938.47
# gear_stamina=46630
# gear_intellect=49413
# gear_crit_rating=7369
# gear_haste_rating=10264
# gear_mastery_rating=6681
# gear_versatility_rating=3849
# gear_armor=2233
# set_bonus=tier19_2pc=1
default_pet=imp

T19 2pc - T20 4pc : 1379808 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1379808.4 1379808.4 2053.0 / 0.149% 201096.3 / 14.6% 43.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
24252.3 24252.3 Mana 0.00% 48.6 99.9% 100%
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Channel Demonfire (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T19 2pc - T20 4pc 1379808
Channel Demonfire 0 (164235) 0.0% (11.9%) 16.1 19.05sec 3065597 1265667

Stats details: channel_demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.08 0.00 240.39 0.00 2.4222 0.1452 0.00 0.00 0.00 1265667.26 1265667.26
 
 

Action details: channel_demonfire

Static Values
  • id:196447
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:52800.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
Spelldata
  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Channel Demonfire (_tick) 164235 11.9% 0.0 0.00sec 0 0 Direct 237.5 166555 333008 207519 24.6%  

Stats details: channel_demonfire_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 237.53 0.00 0.00 0.0000 0.0000 49291411.35 49291411.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.07 75.39% 166555.45 120066 242678 166699.54 156803 177562 29825901 29825901 0.00
crit 58.45 24.61% 333008.46 240132 485344 333289.41 310136 366528 19465510 19465510 0.00
 
 

Action details: channel_demonfire_tick

Static Values
  • id:196448
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Chaos Bolt 401722 29.1% 42.9 6.91sec 2813406 1812377 Direct 43.7 0 2760209 2760209 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.87 43.69 0.00 0.00 1.5523 0.0000 120604651.04 120604651.04 0.00 1812377.35 1812377.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 43.69 100.00% 2760208.67 2187296 3764864 2761345.23 2631797 2896839 120604651 120604651 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=1}} Chaos damage. Damage is further increased by your critical strike chance.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 108727 7.9% 35.3 8.60sec 925620 845646 Direct 35.3 493986 1193203 925625 61.7%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.26 35.26 0.00 0.00 1.0946 0.0000 32634306.75 32634306.75 0.00 845645.53 845645.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.49 38.27% 493986.38 359077 725694 494369.14 437637 564085 6665131 6665131 0.00
crit 21.76 61.73% 1193203.12 718142 1827485 1194141.56 1064066 1360709 25969176 25969176 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 6637 0.5% 13.9 2.13sec 140995 0 Direct 13.9 112737 225735 140994 25.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.90 13.90 0.00 0.00 0.0000 0.0000 1959705.41 1959705.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.42 74.99% 112736.59 98855 130488 112775.77 98855 127381 1175037 1175037 0.00
crit 3.48 25.01% 225735.15 197709 260976 220022.48 0 260976 784668 784668 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 110106 8.0% 17.2 17.92sec 1927617 1724316 Direct 17.2 269412 537456 423743 57.6%  
Periodic 135.9 120646 240956 189984 57.6% 98.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.16 17.16 135.86 135.86 1.1179 2.1859 33084445.67 33084445.67 0.00 104642.31 1724315.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.28 42.42% 269412.41 198321 399070 269625.47 223496 325146 1961628 1961628 0.00
crit 9.88 57.58% 537455.75 396638 801570 537670.97 467539 607283 5311392 5311392 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.6 42.37% 120646.43 251 179432 120745.56 113343 128623 6945062 6945062 0.00
crit 78.3 57.63% 240956.14 273 358814 241132.57 225564 254958 18866364 18866364 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 178183 12.9% 96.6 3.02sec 554349 474744 Direct 96.2 443592 884177 556932 25.7%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.64 96.19 0.00 0.00 1.1677 0.0000 53573404.32 53573404.32 0.00 474743.72 474743.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.45 74.28% 443592.28 330249 667483 443875.75 423148 466210 31694025 31694025 0.00
crit 24.74 25.72% 884177.00 660514 1334525 884748.28 820432 967249 21879379 21879379 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:55000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.84
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Insidious Corruption 13626 1.0% 5.1 60.50sec 808371 0 Periodic 42.8 77030 154050 95764 24.3% 19.8%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.07 0.00 42.79 42.79 0.0000 1.3955 4097863.01 4097863.01 0.00 68627.13 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.4 75.67% 77030.25 1309 103505 77009.74 73109 83834 2494178 2494178 0.00
crit 10.4 24.33% 154049.94 2618 207010 154029.68 109209 170268 1603685 1603685 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Spectral Owl 0 (73935) 0.0% (5.3%) 3.0 120.40sec 7334587 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 0.00 57.41 0.00 0.0000 1.0000 0.00 0.00 0.00 384522.05 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 22974 1.7% 33.4 7.97sec 205542 0 Direct 33.1 166606 332874 206875 24.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.37 33.15 0.00 0.00 0.0000 0.0000 6858049.94 6858049.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.12 75.78% 166606.08 138719 183108 166624.14 154695 176034 4185155 4185155 0.00
crit 8.03 24.22% 332874.40 277437 366217 332850.17 277437 366217 2672895 2672895 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
    Spectral Bolt 50962 3.7% 85.8 3.05sec 177418 0 Direct 85.4 143312 286674 178182 24.3%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.76 85.40 0.00 0.00 0.0000 0.0000 15216207.51 15216207.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.63 75.68% 143312.45 118901 156949 143334.41 136782 150122 9261614 9261614 0.00
crit 20.77 24.32% 286673.71 237802 313898 286736.46 261862 306889 5954594 5954594 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90466.53
  • base_dd_max:99989.32
 
pet - infernal 108935 / 1170
Immolation 45820 0.0% 1.0 0.00sec 145256 0 Periodic 2.0 58286 116705 72645 24.5% 0.9%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 2.00 2.00 0.0000 1.3636 145256.41 145256.41 0.00 53266.01 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.5 75.45% 58285.76 57050 60799 54420.93 0 60799 87952 87952 0.00
crit 0.5 24.55% 116705.13 114100 121599 49541.58 0 121599 57304 57304 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 27574 0.0% 2.0 1.19sec 43743 31906 Direct 2.0 34910 69838 43746 25.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.3715 0.0000 87486.91 128614.05 31.98 31906.24 31906.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.49 74.71% 34909.60 34116 36358 32536.81 0 36358 52161 76682 29.80
crit 0.51 25.29% 69837.83 68232 72716 30569.95 0 72716 35326 51932 14.00
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Meteor Strike 35542 0.0% 1.0 0.00sec 112696 0 Direct 1.0 89730 179192 112668 25.7%  

Stats details: meteor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 112695.64 112695.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.74 74.33% 89730.09 87769 93537 66695.70 0 93537 66696 66696 0.00
crit 0.26 25.67% 179191.66 175538 187075 45999.94 0 187075 46000 46000 0.00
 
 

Action details: meteor_strike

Static Values
  • id:171018
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time>1
Spelldata
  • id:171018
  • name:Meteor Strike
  • school:fire
  • tooltip:Stunned.
  • description:The abyssal releases a powerful burst of flames, dealing {$s1=0} Fire damage to nearby targets, and stunning them for {$d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - doomguard 155545 / 153848
Doom Bolt 155545 11.2% 134.1 2.22sec 344784 155999 Direct 133.4 276347 550477 346734 25.7%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.11 133.36 0.00 0.00 2.2102 0.0000 46239059.50 46239059.50 0.00 155998.54 155998.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.12 74.32% 276346.73 240339 406790 276475.10 267851 289864 27390740 27390740 0.00
crit 34.24 25.68% 550476.83 480678 813580 550711.01 504238 603280 18848320 18848320 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 329939 / 27940
Immolation 206368 1.2% 3.0 0.00sec 1719800 0 Periodic 66.0 62957 125918 78173 24.2% 24.6%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 66.00 66.00 0.0000 1.1193 5159399.11 5159399.11 0.00 69843.36 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.1 75.83% 62956.57 51863 72959 62963.33 58649 68713 3151040 3151040 0.00
crit 15.9 24.17% 125918.06 103727 145918 125907.98 110366 143197 2008359 2008359 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 123571 0.7% 66.0 1.12sec 46809 41822 Direct 66.0 37681 75465 46808 24.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.00 66.00 0.00 0.00 1.1193 0.0000 3089399.44 4541709.81 31.98 41821.55 41821.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.06 75.84% 37680.73 31015 43630 37680.97 34984 40862 1886200 2772893 31.98
crit 15.94 24.16% 75464.84 62029 87260 75473.81 66772 84203 1203199 1768817 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 173724 / 25764
Shadow Bolt 173724 1.9% 3.6 66.82sec 2160276 0 Periodic 35.8 172410 343265 215549 25.3% 16.2%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 35.96 35.75 0.0000 1.3542 7706190.86 7706190.86 0.00 158231.51 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.7 74.75% 172410.01 1278 224492 171853.27 0 218067 4607234 4607234 0.00
crit 9.0 25.25% 343264.52 1255 448983 340098.63 0 448983 3098957 3098957 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 243113 / 71655
Searing Bolt 243113 5.1% 71.7 2.61sec 296791 821565 Direct 71.2 90838 0 90838 0.0%  
Periodic 112.1 105446 209981 132011 25.4% 36.7%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.68 71.22 112.14 112.14 0.3613 0.9848 21272774.22 21272774.22 0.00 156045.70 821564.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.22 100.00% 90837.66 76514 112247 90974.37 0 112247 6469720 6469720 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.6 74.59% 105446.11 882 157176 105210.34 0 125124 8819748 8819748 0.00
crit 28.5 25.41% 209980.51 6643 314352 209417.33 0 270389 5983306 5983306 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=20 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.070000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 369369 / 21528
Chaos Bolt 369369 1.6% 3.6 68.48sec 1805804 812347 Direct 3.6 0 1816809 1816809 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 3.55 0.00 0.00 2.2230 0.0000 6456530.95 6456530.95 0.00 812346.62 812346.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.55 100.00% 1816809.49 1662034 2261471 1817430.00 0 2261471 6456531 6456531 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:8.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 369904 / 23438
Chaos Barrage 369904 1.7% 3.6 67.28sec 1956410 0 Periodic 112.2 49977 99551 62524 25.3% 6.5%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.59 0.00 112.62 112.20 0.0000 0.1735 7015457.23 7015457.23 0.00 359030.56 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.8 74.70% 49977.24 244 61736 49869.34 0 61736 4188976 4188976 0.00
crit 28.4 25.30% 99551.22 794 123473 99394.68 0 123473 2826481 2826481 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
T19 2pc - T20 4pc
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 2pc - T20 4pc
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.54sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 14.1 23.15sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.07 0.00 0.00 0.00 1.1177 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target. |cFFFFFFFFGenerates {$s2=3} Soul Shard Fragments.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 2pc - T20 4pc
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 2pc - T20 4pc
  • harmful:false
  • if_expr:
 
Life Tap 6.0 36.71sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.04 0.00 0.00 0.00 1.1593 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 3.0 121.42sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.soul_harvest.remains
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7764 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Backdraft 33.2 2.1 9.1sec 8.6sec 47.05% 40.00% 0.0(0.0) 1.7

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:15.37%
  • backdraft_2:29.49%
  • backdraft_3:0.76%
  • backdraft_4:1.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Berserking 2.1 0.0 180.5sec 180.5sec 6.88% 10.88% 0.0(0.0) 2.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.55% 13.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.2 35.6sec 25.0sec 32.38% 32.38% 3.2(3.2) 8.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagration of Chaos 17.7 0.0 16.9sec 16.9sec 52.58% 48.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:52.58%

Trigger Attempt Success

  • trigger_pct:50.19%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a {$h=50}% chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Embrace Chaos 29.8 14.1 10.3sec 6.9sec 50.05% 51.39% 14.1(14.1) 29.1

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:50.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.2sec 60.2sec 19.15% 19.15% 0.0(0.0) 4.7

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lessons of Space-Time 10.7 3.4 29.1sec 23.1sec 39.09% 39.09% 3.4(3.4) 10.3

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_lessons_of_spacetime
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • lessons_of_spacetime_1:39.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:236176
  • name:Lessons of Space-Time
  • tooltip:You and your minions deal {$s1=10}% increased damage.
  • description:{$@spelldesc236174=While you have a Dimensional Rift open, all of your damage is increased by {$236176s1=10}%.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 99.63% 99.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.1 4.1 22.9sec 17.2sec 30.06% 30.06% 4.1(4.1) 12.8

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.64% 19.64% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 3.0 0.0 121.4sec 121.4sec 13.43% 100.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • soul_harvest_1:13.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.5 67.9sec
flame_rift 3.6 67.6sec
chaos_tear 3.5 67.6sec
chaos_portal 3.5 67.3sec
dimension_ripper 4.9 48.3sec
t19_2pc_chaos_bolt 18.9 15.7sec

Resources

Resource Usage Type Count Total Average RPE APR
T19 2pc - T20 4pc
channel_demonfire Mana 27.3 1443810.6 52800.0 89795.4 34.1
chaos_bolt Soul Shard 74.6 149.2 2.0 3.5 808320.1
immolate Mana 29.2 1926481.6 66000.0 112243.6 17.2
incinerate Mana 164.4 9040017.0 55000.0 93541.3 5.9
summon_doomguard Soul Shard 1.7 1.7 1.0 1.7 0.0
pet - doomguard
doom_bolt Energy 134.1 4693.8 35.0 35.0 9851.0
pet - flame_rift
searing_bolt Energy 70.5 70.5 1.0 1.0 301539.6
Resource Gains Type Count Total Average Overflow
life_tap Mana 10.28 3392714.29 (31.04%) 330000.00 0.00 0.00%
immolate Soul Shard 231.06 21.93 (14.78%) 0.09 1.18 5.09%
dimensional_rift Soul Shard 23.93 6.80 (4.58%) 0.28 0.38 5.23%
conflagrate Soul Shard 59.96 29.28 (19.73%) 0.49 0.70 2.32%
incinerate Soul Shard 164.36 32.51 (21.90%) 0.20 0.36 1.10%
mp5_regen Mana 1310.42 7536055.42 (68.96%) 5750.85 112785.35 1.47%
immolate_crits Soul Shard 66.50 6.34 (4.27%) 0.10 0.31 4.66%
soulsnatcher Soul Shard 11.20 11.20 (7.54%) 1.00 0.00 0.00%
feretory_of_souls Soul Shard 21.14 19.99 (13.47%) 0.95 1.15 5.45%
incinerate_crits Soul Shard 42.29 4.17 (2.81%) 0.10 0.06 1.33%
destruction_t20_2pc Soul Shard 164.36 16.20 (10.92%) 0.10 0.24 1.43%
pet - doomguard
energy_regen Energy 228.08 7923.13 (100.00%) 34.74 264.51 3.23%
Resource RPS-Gain RPS-Loss
Health 0.00 9148.61
Mana 21357.27 24252.29
Soul Shard 0.29 0.29
Combat End Resource Mean Min Max
Mana 231995.22 5375.51 472201.18
Soul Shard 1.56 0.10 4.70

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.7%

Statistics & Data Analysis

Fight Length
Sample Data T19 2pc - T20 4pc Fight Length
Count 2497
Mean 300.88
Minimum 210.35
Maximum 392.56
Spread ( max - min ) 182.21
Range [ ( max - min ) / 2 * 100% ] 30.28%
Standard Deviation 40.8429
5th Percentile 241.20
95th Percentile 366.21
( 95th Percentile - 5th Percentile ) 125.01
Mean Distribution
Standard Deviation 0.8173
95.00% Confidence Intervall ( 299.28 - 302.48 )
Normalized 95.00% Confidence Intervall ( 99.47% - 100.53% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 708
0.1% Error 70785
0.1 Scale Factor Error with Delta=300 15
0.05 Scale Factor Error with Delta=300 57
0.01 Scale Factor Error with Delta=300 1425
DPS
Sample Data T19 2pc - T20 4pc Damage Per Second
Count 2497
Mean 1379808.44
Minimum 1191075.72
Maximum 1569598.26
Spread ( max - min ) 378522.54
Range [ ( max - min ) / 2 * 100% ] 13.72%
Standard Deviation 52342.1046
5th Percentile 1300518.08
95th Percentile 1470007.71
( 95th Percentile - 5th Percentile ) 169489.62
Mean Distribution
Standard Deviation 1047.4708
95.00% Confidence Intervall ( 1377755.44 - 1381861.45 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5528
0.1 Scale Factor Error with Delta=300 23387621
0.05 Scale Factor Error with Delta=300 93550481
0.01 Scale Factor Error with Delta=300 2338762006
Priority Target DPS
Sample Data T19 2pc - T20 4pc Priority Target Damage Per Second
Count 2497
Mean 1379808.44
Minimum 1191075.72
Maximum 1569598.26
Spread ( max - min ) 378522.54
Range [ ( max - min ) / 2 * 100% ] 13.72%
Standard Deviation 52342.1046
5th Percentile 1300518.08
95th Percentile 1470007.71
( 95th Percentile - 5th Percentile ) 169489.62
Mean Distribution
Standard Deviation 1047.4708
95.00% Confidence Intervall ( 1377755.44 - 1381861.45 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5528
0.1 Scale Factor Error with Delta=300 23387621
0.05 Scale Factor Error with Delta=300 93550481
0.01 Scale Factor Error with Delta=300 2338762006
DPS(e)
Sample Data T19 2pc - T20 4pc Damage Per Second (Effective)
Count 2497
Mean 1379808.44
Minimum 1191075.72
Maximum 1569598.26
Spread ( max - min ) 378522.54
Range [ ( max - min ) / 2 * 100% ] 13.72%
Damage
Sample Data T19 2pc - T20 4pc Damage
Count 2497
Mean 317320045.00
Minimum 226911947.78
Maximum 397790598.74
Spread ( max - min ) 170878650.97
Range [ ( max - min ) / 2 * 100% ] 26.93%
DTPS
Sample Data T19 2pc - T20 4pc Damage Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T19 2pc - T20 4pc Healing Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T19 2pc - T20 4pc Healing Per Second (Effective)
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T19 2pc - T20 4pc Heal
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T19 2pc - T20 4pc Healing Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T19 2pc - T20 4pc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data T19 2pc - T20 4pcTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T19 2pc - T20 4pc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
0.00 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
C 1.12 dimensional_rift,if=charges=3
0.00 cataclysm,if=spell_targets.cataclysm>=3
D 5.39 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
0.00 immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
E 2.07 berserking
0.00 blood_fury
F 8.08 use_items
G 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
H 18.09 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
I 0.23 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
J 1.17 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
0.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
K 1.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
L 2.96 soul_harvest,if=!buff.soul_harvest.remains
0.00 chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
M 16.08 channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
0.00 rain_of_fire,if=active_enemies>=3
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
N 11.78 dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
O 1.93 chaos_bolt,if=active_enemies<3&target.time_to_die<=10
P 41.10 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
0.00 shadowburn
Q 16.94 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
R 11.83 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
S 97.00 incinerate
T 6.05 life_tap

Sample Sequence

0136ABCDEFHKLMNPIHSPSSSSSHPMDSSHFSSSSSSHPSSMRSQPSSPSSHNPSMRPPQSSPSQSSNSRMHSPSSTSQFPSSRPMNQSSSPQPSSPPRQMSSPSQSSFTRJLGPHSMSPSQSSSRFSSSHPMPPSQSTRSSSQSSSMPHPSRSNSETQPSSMPQSRSNSPQFSSSPMPPQRSSSHSTSPNSMPDPQSQSSFSPLSSHMDPNSQSSSTFSSSQPDMNSQOOSSOS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T19 2pc - T20 4pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food T19 2pc - T20 4pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_infernal Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation T19 2pc - T20 4pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:00.000 default C dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:01.148 default D immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.3/5: 46% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:02.034 default E berserking Fluffy_Pillow 1034112.4/1100000: 94% mana | 2.3/5: 46% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:02.034 default F use_items Fluffy_Pillow 1034112.4/1100000: 94% mana | 2.3/5: 46% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:02.034 default H conflagrate Fluffy_Pillow 1034112.4/1100000: 94% mana | 2.3/5: 46% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:02.804 default K summon_doomguard Fluffy_Pillow 1050705.2/1100000: 96% mana | 2.8/5: 56% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:03.575 default L soul_harvest Fluffy_Pillow 1067319.6/1100000: 97% mana | 1.8/5: 36% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:03.575 default M channel_demonfire Fluffy_Pillow 1067319.6/1100000: 97% mana | 1.8/5: 36% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:05.460 default N dimensional_rift Fluffy_Pillow 1055139.6/1100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:06.230 default P chaos_bolt Fluffy_Pillow 1071631.5/1100000: 97% mana | 2.3/5: 46% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:07.329 default I conflagrate Fluffy_Pillow 1094832.0/1100000: 100% mana | 0.5/5: 10% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:08.114 default H conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:08.945 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.6/5: 32% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:09.700 default P chaos_bolt Fluffy_Pillow 1047111.8/1100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(3), lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:10.454 default S incinerate Fluffy_Pillow 1063359.8/1100000: 97% mana | 0.1/5: 2% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:11.209 default S incinerate Fluffy_Pillow 1024629.4/1100000: 93% mana | 0.5/5: 10% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:11.962 default S incinerate Fluffy_Pillow 985855.9/1100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:12.905 default S incinerate Fluffy_Pillow 948728.5/1100000: 86% mana | 1.3/5: 26% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:13.990 default S incinerate Fluffy_Pillow 914059.6/1100000: 83% mana | 1.7/5: 34% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:15.073 default H conflagrate Fluffy_Pillow 879005.0/1100000: 80% mana | 2.1/5: 42% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, potion_of_prolonged_power
0:15.975 default P chaos_bolt Fluffy_Pillow 895563.1/1100000: 81% mana | 2.6/5: 52% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:17.237 default M channel_demonfire Fluffy_Pillow 918985.9/1100000: 84% mana | 0.8/5: 16% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:19.238 default D immolate Fluffy_Pillow 903681.3/1100000: 82% mana | 0.9/5: 18% soul_shard bloodlust, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:20.122 default S incinerate Fluffy_Pillow 854246.0/1100000: 78% mana | 1.1/5: 22% soul_shard bloodlust, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:20.883 default S incinerate Fluffy_Pillow 813505.8/1100000: 74% mana | 1.4/5: 28% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:21.968 default H conflagrate Fluffy_Pillow 778836.9/1100000: 71% mana | 1.8/5: 36% soul_shard bloodlust, lord_of_flames, mark_of_the_claw, potion_of_prolonged_power
0:22.853 default F use_items Fluffy_Pillow 795310.5/1100000: 72% mana | 2.3/5: 46% soul_shard bloodlust, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:22.853 default S incinerate Fluffy_Pillow 795310.5/1100000: 72% mana | 2.3/5: 46% soul_shard bloodlust, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:23.630 default S incinerate Fluffy_Pillow 754573.9/1100000: 69% mana | 2.6/5: 52% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_prolonged_power
0:24.403 default S incinerate Fluffy_Pillow 713763.9/1100000: 65% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:25.509 default S incinerate Fluffy_Pillow 679066.7/1100000: 62% mana | 3.5/5: 70% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:26.615 default S incinerate Fluffy_Pillow 644369.6/1100000: 59% mana | 3.9/5: 78% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:27.722 default S incinerate Fluffy_Pillow 609690.8/1100000: 55% mana | 4.4/5: 88% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:28.829 default H conflagrate Fluffy_Pillow 575012.0/1100000: 52% mana | 4.7/5: 94% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:29.787 default P chaos_bolt Fluffy_Pillow 592598.0/1100000: 54% mana | 5.0/5: 100% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:31.049 default S incinerate Fluffy_Pillow 615764.6/1100000: 56% mana | 3.0/5: 60% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:31.825 default S incinerate Fluffy_Pillow 575009.6/1100000: 52% mana | 3.3/5: 66% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:32.931 default M channel_demonfire Fluffy_Pillow 540312.4/1100000: 49% mana | 3.9/5: 78% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:34.916 default R immolate Fluffy_Pillow 523951.1/1100000: 48% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:35.819 default S incinerate Fluffy_Pillow 474527.5/1100000: 43% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, extracted_sanity, potion_of_prolonged_power
0:36.926 default Q conflagrate Fluffy_Pillow 439848.7/1100000: 40% mana | 4.4/5: 88% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, extracted_sanity, potion_of_prolonged_power
0:37.828 default P chaos_bolt Fluffy_Pillow 456406.7/1100000: 41% mana | 5.0/5: 100% soul_shard bloodlust, backdraft(2), lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:39.090 default S incinerate Fluffy_Pillow 479573.2/1100000: 44% mana | 3.0/5: 60% soul_shard bloodlust, backdraft, lord_of_flames, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:39.866 default S incinerate Fluffy_Pillow 438818.3/1100000: 40% mana | 3.5/5: 70% soul_shard bloodlust, lord_of_flames, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:40.974 default P chaos_bolt Fluffy_Pillow 404157.8/1100000: 37% mana | 4.8/5: 96% soul_shard bloodlust, lord_of_flames, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:42.057 default S incinerate Fluffy_Pillow 419450.6/1100000: 38% mana | 2.9/5: 58% soul_shard lord_of_flames, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:43.496 default S incinerate Fluffy_Pillow 384770.4/1100000: 35% mana | 3.2/5: 64% soul_shard lord_of_flames, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:44.933 default H conflagrate Fluffy_Pillow 350062.0/1100000: 32% mana | 3.7/5: 74% soul_shard lord_of_flames, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:46.104 default N dimensional_rift Fluffy_Pillow 366597.4/1100000: 33% mana | 4.2/5: 84% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity, potion_of_prolonged_power
0:47.277 default P chaos_bolt Fluffy_Pillow 383161.1/1100000: 35% mana | 4.6/5: 92% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:48.918 default S incinerate Fluffy_Pillow 406333.3/1100000: 37% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:49.924 default M channel_demonfire Fluffy_Pillow 365538.8/1100000: 33% mana | 3.1/5: 62% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:52.486 default R immolate Fluffy_Pillow 348916.2/1100000: 32% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:53.658 default P chaos_bolt Fluffy_Pillow 299465.7/1100000: 27% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.997 default P chaos_bolt Fluffy_Pillow 332494.2/1100000: 30% mana | 2.6/5: 52% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.402 default Q conflagrate Fluffy_Pillow 352335.1/1100000: 32% mana | 0.6/5: 12% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.550 default S incinerate Fluffy_Pillow 368882.5/1100000: 34% mana | 1.3/5: 26% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
0:59.537 default S incinerate Fluffy_Pillow 328109.2/1100000: 30% mana | 1.6/5: 32% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:00.523 default P chaos_bolt Fluffy_Pillow 287321.5/1100000: 26% mana | 2.1/5: 42% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:01.900 default S incinerate Fluffy_Pillow 307169.7/1100000: 28% mana | 1.1/5: 22% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:03.308 default Q conflagrate Fluffy_Pillow 272464.8/1100000: 25% mana | 1.6/5: 32% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:04.457 default S incinerate Fluffy_Pillow 288716.0/1100000: 26% mana | 2.1/5: 42% soul_shard backdraft(2), lord_of_flames, embrace_chaos
1:05.464 default S incinerate Fluffy_Pillow 247935.6/1100000: 23% mana | 2.5/5: 50% soul_shard backdraft, lord_of_flames, embrace_chaos
1:06.472 default N dimensional_rift Fluffy_Pillow 207169.3/1100000: 19% mana | 2.8/5: 56% soul_shard lord_of_flames
1:07.644 default S incinerate Fluffy_Pillow 223718.9/1100000: 20% mana | 3.2/5: 64% soul_shard lessons_of_spacetime, lord_of_flames
1:09.081 default R immolate Fluffy_Pillow 189010.4/1100000: 17% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, lord_of_flames
1:10.255 default M channel_demonfire Fluffy_Pillow 139588.2/1100000: 13% mana | 3.7/5: 74% soul_shard lessons_of_spacetime, lord_of_flames
1:12.828 default H conflagrate Fluffy_Pillow 123120.9/1100000: 11% mana | 3.8/5: 76% soul_shard lessons_of_spacetime, lord_of_flames
1:14.001 default S incinerate Fluffy_Pillow 139684.6/1100000: 13% mana | 4.3/5: 86% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos
1:15.008 default P chaos_bolt Fluffy_Pillow 99149.2/1100000: 9% mana | 4.7/5: 94% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:16.614 default S incinerate Fluffy_Pillow 122298.2/1100000: 11% mana | 2.8/5: 56% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
1:18.022 default S incinerate Fluffy_Pillow 87593.3/1100000: 8% mana | 3.2/5: 64% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
1:19.431 default T life_tap Fluffy_Pillow 52902.8/1100000: 5% mana | 3.7/5: 74% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
1:20.579 default S incinerate Fluffy_Pillow 399331.1/1100000: 36% mana | 3.7/5: 74% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:22.016 default Q conflagrate Fluffy_Pillow 364622.6/1100000: 33% mana | 4.1/5: 82% soul_shard lord_of_flames, conflagration_of_chaos
1:23.189 default F use_items Fluffy_Pillow 381186.3/1100000: 35% mana | 4.6/5: 92% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
1:23.189 default P chaos_bolt Fluffy_Pillow 381186.3/1100000: 35% mana | 4.6/5: 92% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
1:24.828 default S incinerate Fluffy_Pillow 404330.2/1100000: 37% mana | 3.7/5: 74% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:25.834 default S incinerate Fluffy_Pillow 363535.7/1100000: 33% mana | 4.1/5: 82% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:27.270 default R immolate Fluffy_Pillow 328813.2/1100000: 30% mana | 4.4/5: 88% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:28.444 default P chaos_bolt Fluffy_Pillow 279390.9/1100000: 25% mana | 4.6/5: 92% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:29.850 default M channel_demonfire Fluffy_Pillow 299244.8/1100000: 27% mana | 2.6/5: 52% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:32.328 default N dimensional_rift Fluffy_Pillow 281436.0/1100000: 26% mana | 2.7/5: 54% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:33.500 default Q conflagrate Fluffy_Pillow 297985.6/1100000: 27% mana | 3.2/5: 64% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:34.674 default S incinerate Fluffy_Pillow 314563.4/1100000: 29% mana | 3.7/5: 74% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos
1:35.682 default S incinerate Fluffy_Pillow 273797.1/1100000: 25% mana | 4.1/5: 82% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
1:36.693 default S incinerate Fluffy_Pillow 233073.2/1100000: 21% mana | 4.5/5: 90% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
1:38.131 default P chaos_bolt Fluffy_Pillow 198378.9/1100000: 18% mana | 4.9/5: 98% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
1:40.470 default Q conflagrate Fluffy_Pillow 231407.4/1100000: 21% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
1:41.641 default P chaos_bolt Fluffy_Pillow 247942.8/1100000: 23% mana | 4.5/5: 90% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
1:42.627 default S incinerate Fluffy_Pillow 262017.2/1100000: 24% mana | 3.6/5: 72% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, mark_of_the_claw
1:43.612 default S incinerate Fluffy_Pillow 221215.1/1100000: 20% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, mark_of_the_claw
1:45.021 default P chaos_bolt Fluffy_Pillow 186524.6/1100000: 17% mana | 4.5/5: 90% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:46.398 default P chaos_bolt Fluffy_Pillow 206372.8/1100000: 19% mana | 2.5/5: 50% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:47.775 default R immolate Fluffy_Pillow 226221.1/1100000: 21% mana | 0.7/5: 14% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:48.924 default Q conflagrate Fluffy_Pillow 176544.4/1100000: 16% mana | 0.7/5: 14% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
1:50.280 default M channel_demonfire Fluffy_Pillow 195692.2/1100000: 18% mana | 1.3/5: 26% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
1:52.915 default S incinerate Fluffy_Pillow 180100.4/1100000: 16% mana | 1.4/5: 28% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
1:53.922 default S incinerate Fluffy_Pillow 139320.0/1100000: 13% mana | 1.9/5: 38% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
1:54.930 default P chaos_bolt Fluffy_Pillow 98553.7/1100000: 9% mana | 2.2/5: 44% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
1:57.270 default S incinerate Fluffy_Pillow 131596.4/1100000: 12% mana | 0.4/5: 8% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
1:58.706 default Q conflagrate Fluffy_Pillow 96873.8/1100000: 9% mana | 0.8/5: 16% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
1:59.879 default S incinerate Fluffy_Pillow 113437.5/1100000: 10% mana | 1.3/5: 26% soul_shard backdraft(2), lord_of_flames, embrace_chaos
2:00.886 default S incinerate Fluffy_Pillow 72657.1/1100000: 7% mana | 1.8/5: 36% soul_shard backdraft, lord_of_flames, embrace_chaos
2:01.894 default F use_items Fluffy_Pillow 31890.8/1100000: 3% mana | 2.1/5: 42% soul_shard lord_of_flames
2:01.894 default T life_tap Fluffy_Pillow 31890.8/1100000: 3% mana | 2.1/5: 42% soul_shard lord_of_flames
2:03.067 default R immolate Fluffy_Pillow 378454.5/1100000: 34% mana | 2.2/5: 44% soul_shard lord_of_flames
2:04.239 default J dimensional_rift Fluffy_Pillow 329004.0/1100000: 30% mana | 2.2/5: 44% soul_shard lord_of_flames
2:05.413 default L soul_harvest Fluffy_Pillow 345581.8/1100000: 31% mana | 2.6/5: 52% soul_shard lessons_of_spacetime, lord_of_flames
2:05.413 default G potion Fluffy_Pillow 345581.8/1100000: 31% mana | 2.6/5: 52% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames
2:05.413 default P chaos_bolt Fluffy_Pillow 345581.8/1100000: 31% mana | 2.6/5: 52% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, potion_of_deadly_grace
2:07.755 default H conflagrate Fluffy_Pillow 378652.7/1100000: 34% mana | 0.7/5: 14% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:08.974 default S incinerate Fluffy_Pillow 395865.9/1100000: 36% mana | 1.2/5: 24% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:09.979 default M channel_demonfire Fluffy_Pillow 355057.3/1100000: 32% mana | 1.5/5: 30% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:12.534 default S incinerate Fluffy_Pillow 338335.8/1100000: 31% mana | 1.8/5: 36% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:13.542 default P chaos_bolt Fluffy_Pillow 297569.6/1100000: 27% mana | 2.1/5: 42% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:15.885 default S incinerate Fluffy_Pillow 330654.6/1100000: 30% mana | 0.3/5: 6% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:17.321 default Q conflagrate Fluffy_Pillow 295932.0/1100000: 27% mana | 0.8/5: 16% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:18.491 default S incinerate Fluffy_Pillow 312453.3/1100000: 28% mana | 1.3/5: 26% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:19.499 default S incinerate Fluffy_Pillow 271687.0/1100000: 25% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:20.506 default S incinerate Fluffy_Pillow 230906.6/1100000: 21% mana | 3.1/5: 62% soul_shard lord_of_flames, potion_of_deadly_grace
2:21.944 default R immolate Fluffy_Pillow 196212.3/1100000: 18% mana | 3.5/5: 70% soul_shard lord_of_flames, potion_of_deadly_grace
2:23.116 default F use_items Fluffy_Pillow 146761.9/1100000: 13% mana | 3.5/5: 70% soul_shard lord_of_flames, potion_of_deadly_grace
2:23.116 default S incinerate Fluffy_Pillow 146761.9/1100000: 13% mana | 3.5/5: 70% soul_shard lord_of_flames, potion_of_deadly_grace
2:24.553 default S incinerate Fluffy_Pillow 112054.6/1100000: 10% mana | 3.9/5: 78% soul_shard lord_of_flames, mark_of_the_claw, potion_of_deadly_grace
2:25.962 default S incinerate Fluffy_Pillow 77364.1/1100000: 7% mana | 4.2/5: 84% soul_shard lord_of_flames, mark_of_the_claw, potion_of_deadly_grace
2:27.372 default H conflagrate Fluffy_Pillow 42688.0/1100000: 4% mana | 4.6/5: 92% soul_shard lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:28.520 default P chaos_bolt Fluffy_Pillow 59235.4/1100000: 5% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:30.126 default M channel_demonfire Fluffy_Pillow 82384.4/1100000: 7% mana | 4.0/5: 80% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:32.762 default P chaos_bolt Fluffy_Pillow 66930.8/1100000: 6% mana | 4.1/5: 82% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:33.747 default P chaos_bolt Fluffy_Pillow 80839.8/1100000: 7% mana | 2.2/5: 44% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:35.154 default S incinerate Fluffy_Pillow 100707.7/1100000: 9% mana | 0.2/5: 4% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_deadly_grace
2:36.591 default Q conflagrate Fluffy_Pillow 65999.3/1100000: 6% mana | 0.6/5: 12% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
2:37.762 default S incinerate Fluffy_Pillow 82534.7/1100000: 8% mana | 1.1/5: 22% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
2:38.771 default T life_tap Fluffy_Pillow 41782.6/1100000: 4% mana | 1.7/5: 34% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
2:39.941 default R immolate Fluffy_Pillow 388303.9/1100000: 35% mana | 1.7/5: 34% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
2:41.114 default S incinerate Fluffy_Pillow 338867.5/1100000: 31% mana | 1.8/5: 36% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
2:42.121 default S incinerate Fluffy_Pillow 298087.2/1100000: 27% mana | 2.1/5: 42% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
2:43.558 default S incinerate Fluffy_Pillow 263378.7/1100000: 24% mana | 2.6/5: 52% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
2:44.995 default Q conflagrate Fluffy_Pillow 228670.3/1100000: 21% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
2:46.236 default S incinerate Fluffy_Pillow 246194.1/1100000: 22% mana | 3.5/5: 70% soul_shard backdraft(2), lord_of_flames, extracted_sanity
2:47.243 default S incinerate Fluffy_Pillow 205413.8/1100000: 19% mana | 3.8/5: 76% soul_shard backdraft, lord_of_flames
2:48.250 default S incinerate Fluffy_Pillow 164633.4/1100000: 15% mana | 4.2/5: 84% soul_shard lord_of_flames
2:49.687 default M channel_demonfire Fluffy_Pillow 129924.9/1100000: 12% mana | 4.7/5: 94% soul_shard lord_of_flames
2:52.193 default P chaos_bolt Fluffy_Pillow 112511.6/1100000: 10% mana | 4.9/5: 98% soul_shard lord_of_flames
2:54.534 default H conflagrate Fluffy_Pillow 145568.3/1100000: 13% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos
2:55.706 default P chaos_bolt Fluffy_Pillow 162117.9/1100000: 15% mana | 4.5/5: 90% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
2:56.693 default S incinerate Fluffy_Pillow 176055.1/1100000: 16% mana | 2.6/5: 52% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:57.701 default R immolate Fluffy_Pillow 135288.8/1100000: 12% mana | 2.9/5: 58% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:58.873 default S incinerate Fluffy_Pillow 85838.4/1100000: 8% mana | 2.9/5: 58% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:00.309 default N dimensional_rift Fluffy_Pillow 51115.8/1100000: 5% mana | 3.3/5: 66% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:01.481 default S incinerate Fluffy_Pillow 67665.3/1100000: 6% mana | 3.7/5: 74% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
3:02.917 default E berserking Fluffy_Pillow 32942.8/1100000: 3% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
3:02.917 default T life_tap Fluffy_Pillow 32942.8/1100000: 3% mana | 4.0/5: 80% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
3:03.937 default Q conflagrate Fluffy_Pillow 379506.4/1100000: 35% mana | 4.2/5: 84% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
3:04.957 default P chaos_bolt Fluffy_Pillow 396070.1/1100000: 36% mana | 4.7/5: 94% soul_shard berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos
3:06.386 default S incinerate Fluffy_Pillow 419275.5/1100000: 38% mana | 2.9/5: 58% soul_shard berserking, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:07.264 default S incinerate Fluffy_Pillow 378533.2/1100000: 34% mana | 3.2/5: 64% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:08.515 default M channel_demonfire Fluffy_Pillow 343848.1/1100000: 31% mana | 3.6/5: 72% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:10.732 default P chaos_bolt Fluffy_Pillow 327049.7/1100000: 30% mana | 4.7/5: 94% soul_shard berserking, lord_of_flames, conflagration_of_chaos
3:12.766 default Q conflagrate Fluffy_Pillow 360079.6/1100000: 33% mana | 2.9/5: 58% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:13.787 default S incinerate Fluffy_Pillow 374816.7/1100000: 34% mana | 3.4/5: 68% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
3:14.797 default R immolate Fluffy_Pillow 334078.7/1100000: 30% mana | 3.8/5: 76% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:15.968 default S incinerate Fluffy_Pillow 284614.1/1100000: 26% mana | 3.8/5: 76% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:16.974 default N dimensional_rift Fluffy_Pillow 243819.6/1100000: 22% mana | 4.2/5: 84% soul_shard lord_of_flames, conflagration_of_chaos
3:18.149 default S incinerate Fluffy_Pillow 260411.5/1100000: 24% mana | 4.5/5: 90% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
3:19.586 default P chaos_bolt Fluffy_Pillow 225703.1/1100000: 21% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
3:21.927 default Q conflagrate Fluffy_Pillow 259075.5/1100000: 24% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:23.075 default F use_items Fluffy_Pillow 275622.8/1100000: 25% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:23.075 default S incinerate Fluffy_Pillow 275622.8/1100000: 25% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:24.060 default S incinerate Fluffy_Pillow 234820.7/1100000: 21% mana | 4.1/5: 82% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:25.048 default S incinerate Fluffy_Pillow 194061.9/1100000: 18% mana | 4.5/5: 90% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:26.456 default P chaos_bolt Fluffy_Pillow 159356.9/1100000: 14% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:28.750 default M channel_demonfire Fluffy_Pillow 191865.9/1100000: 17% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:31.268 default P chaos_bolt Fluffy_Pillow 174622.0/1100000: 16% mana | 4.1/5: 82% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:32.674 default P chaos_bolt Fluffy_Pillow 194475.8/1100000: 18% mana | 2.3/5: 46% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:34.076 default Q conflagrate Fluffy_Pillow 214273.1/1100000: 19% mana | 0.3/5: 6% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:35.248 default R immolate Fluffy_Pillow 230822.6/1100000: 21% mana | 0.9/5: 18% soul_shard backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
3:36.420 default S incinerate Fluffy_Pillow 181372.2/1100000: 16% mana | 1.9/5: 38% soul_shard backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
3:37.427 default S incinerate Fluffy_Pillow 140591.8/1100000: 13% mana | 2.4/5: 48% soul_shard backdraft, lord_of_flames, embrace_chaos, extracted_sanity
3:38.432 default S incinerate Fluffy_Pillow 99783.2/1100000: 9% mana | 2.7/5: 54% soul_shard lord_of_flames, extracted_sanity
3:39.870 default H conflagrate Fluffy_Pillow 65088.9/1100000: 6% mana | 3.1/5: 62% soul_shard lord_of_flames, extracted_sanity
3:41.040 default S incinerate Fluffy_Pillow 81610.2/1100000: 7% mana | 3.6/5: 72% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity
3:42.047 default T life_tap Fluffy_Pillow 40829.8/1100000: 4% mana | 4.1/5: 82% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
3:43.220 default S incinerate Fluffy_Pillow 387393.5/1100000: 35% mana | 4.1/5: 82% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
3:44.225 default P chaos_bolt Fluffy_Pillow 346584.8/1100000: 32% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
3:46.566 default N dimensional_rift Fluffy_Pillow 379641.6/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
3:47.738 default S incinerate Fluffy_Pillow 396191.1/1100000: 36% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:49.176 default M channel_demonfire Fluffy_Pillow 361496.8/1100000: 33% mana | 3.7/5: 74% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:51.747 default P chaos_bolt Fluffy_Pillow 345001.3/1100000: 31% mana | 3.8/5: 76% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:54.088 default D immolate Fluffy_Pillow 378058.0/1100000: 34% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:55.262 default P chaos_bolt Fluffy_Pillow 328635.8/1100000: 30% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:56.667 default Q conflagrate Fluffy_Pillow 348475.5/1100000: 32% mana | 0.1/5: 2% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:57.840 default S incinerate Fluffy_Pillow 365039.2/1100000: 33% mana | 0.6/5: 12% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:58.847 default Q conflagrate Fluffy_Pillow 324468.2/1100000: 29% mana | 1.1/5: 22% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:59.994 default S incinerate Fluffy_Pillow 341001.2/1100000: 31% mana | 1.6/5: 32% soul_shard backdraft(3), lord_of_flames, embrace_chaos, mark_of_the_claw
4:00.980 default S incinerate Fluffy_Pillow 300213.5/1100000: 27% mana | 2.0/5: 40% soul_shard backdraft(2), lord_of_flames, mark_of_the_claw
4:01.968 default F use_items Fluffy_Pillow 259454.6/1100000: 24% mana | 2.3/5: 46% soul_shard backdraft, lord_of_flames, mark_of_the_claw
4:01.968 default S incinerate Fluffy_Pillow 259454.6/1100000: 24% mana | 2.3/5: 46% soul_shard backdraft, lord_of_flames, mark_of_the_claw
4:02.954 default P chaos_bolt Fluffy_Pillow 218667.0/1100000: 20% mana | 2.7/5: 54% soul_shard lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
4:05.249 default L soul_harvest Fluffy_Pillow 251420.0/1100000: 23% mana | 0.8/5: 16% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall
4:05.413 default S incinerate Fluffy_Pillow 253735.8/1100000: 23% mana | 0.8/5: 16% soul_shard soul_harvest, lord_of_flames, embrace_chaos, concordance_of_the_legionfall
4:06.851 default S incinerate Fluffy_Pillow 219041.4/1100000: 20% mana | 1.1/5: 22% soul_shard soul_harvest, lord_of_flames, embrace_chaos, concordance_of_the_legionfall
4:08.290 default H conflagrate Fluffy_Pillow 184361.2/1100000: 17% mana | 1.5/5: 30% soul_shard soul_harvest, lord_of_flames, embrace_chaos, concordance_of_the_legionfall
4:09.463 default M channel_demonfire Fluffy_Pillow 200924.9/1100000: 18% mana | 2.0/5: 40% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:12.083 default D immolate Fluffy_Pillow 185121.3/1100000: 17% mana | 2.3/5: 46% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:13.253 default P chaos_bolt Fluffy_Pillow 135642.6/1100000: 12% mana | 2.3/5: 46% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:14.891 default N dimensional_rift Fluffy_Pillow 158772.5/1100000: 14% mana | 0.5/5: 10% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
4:16.066 default S incinerate Fluffy_Pillow 175364.4/1100000: 16% mana | 0.8/5: 16% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
4:17.074 default Q conflagrate Fluffy_Pillow 134598.1/1100000: 12% mana | 1.2/5: 24% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
4:18.248 default S incinerate Fluffy_Pillow 151175.9/1100000: 14% mana | 1.7/5: 34% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
4:19.256 default S incinerate Fluffy_Pillow 110409.6/1100000: 10% mana | 2.3/5: 46% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:20.263 default S incinerate Fluffy_Pillow 69629.3/1100000: 6% mana | 2.6/5: 52% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
4:21.701 default T life_tap Fluffy_Pillow 35103.6/1100000: 3% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
4:22.848 default F use_items Fluffy_Pillow 381636.6/1100000: 35% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
4:22.848 default S incinerate Fluffy_Pillow 381636.6/1100000: 35% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
4:24.256 default S incinerate Fluffy_Pillow 346931.6/1100000: 32% mana | 3.5/5: 70% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
4:25.664 default S incinerate Fluffy_Pillow 312226.7/1100000: 28% mana | 3.8/5: 76% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
4:27.072 default Q conflagrate Fluffy_Pillow 277521.8/1100000: 25% mana | 4.2/5: 84% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
4:28.220 default P chaos_bolt Fluffy_Pillow 293748.3/1100000: 27% mana | 4.8/5: 96% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
4:29.859 default D immolate Fluffy_Pillow 316892.2/1100000: 29% mana | 2.8/5: 56% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:31.032 default M channel_demonfire Fluffy_Pillow 267455.9/1100000: 24% mana | 2.9/5: 58% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:33.631 default N dimensional_rift Fluffy_Pillow 251355.8/1100000: 23% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:34.804 default S incinerate Fluffy_Pillow 267919.4/1100000: 24% mana | 3.4/5: 68% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
4:36.243 default Q conflagrate Fluffy_Pillow 233239.2/1100000: 21% mana | 3.7/5: 74% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
4:37.416 default O chaos_bolt Fluffy_Pillow 249802.9/1100000: 23% mana | 4.3/5: 86% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity
4:39.055 default O chaos_bolt Fluffy_Pillow 272946.8/1100000: 25% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
4:40.041 default S incinerate Fluffy_Pillow 286871.4/1100000: 26% mana | 1.4/5: 28% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, mark_of_the_claw
4:41.450 default S incinerate Fluffy_Pillow 252180.9/1100000: 23% mana | 1.8/5: 36% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, mark_of_the_claw
4:42.860 default O chaos_bolt Fluffy_Pillow 217504.7/1100000: 20% mana | 2.3/5: 46% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, mark_of_the_claw
4:44.237 default S incinerate Fluffy_Pillow 237353.0/1100000: 22% mana | 0.4/5: 8% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 75895 75895 46630
Intellect 61279 59573 49413 (4609)
Spirit 1 1 0
Health 4553700 4553700 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 61279 59573 0
Crit 23.42% 23.42% 7369
Haste 28.37% 27.37% 10264
Damage / Heal Versatility 8.10% 8.10% 3849
ManaReg per Second 14121 14011 0
Mastery 49.40% 49.40% 6681
Armor 2233 2233 2233
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 938.00
Local Head Diabolic Helm
ilevel: 930, stats: { 281 Armor, +4305 Sta, +2870 Int, +1082 Crit, +766 Mastery }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Lessons of Space-Time
ilevel: 970, stats: { 300 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Chest Diabolic Robe
ilevel: 930, stats: { 346 Armor, +4305 Sta, +2870 Int, +1241 Haste, +607 Vers }
Local Waist Feretory of Souls
ilevel: 970, stats: { 225 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Legs Diabolic Leggings
ilevel: 930, stats: { 303 Armor, +4305 Sta, +2870 Int, +1162 Mastery, +686 Haste }
Local Feet Slippers of Enduring Vigilance
ilevel: 930, stats: { 238 Armor, +3229 Sta, +2153 Int, +931 Haste, +455 Mastery }
Local Wrists Oathbreaker's Cuffs
ilevel: 930, stats: { 151 Armor, +2422 Sta, +1615 Int, +676 Crit, +364 Vers }
Local Hands Gloves of Furtive Oppression
ilevel: 930, stats: { 216 Armor, +3229 Sta, +2153 Int, +812 Crit, +574 Mastery }
Local Finger1 Yathae's Thumb Ring
ilevel: 930, stats: { +2422 Sta, +2414 Crit, +1106 Vers }, enchant: { +200 Haste }
Local Finger2 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Diabolic Shroud
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +676 Crit, +364 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 957, weapon: { 9093 - 13641, 3.6 }, stats: { +3691 Int, +5537 Sta, +1024 Haste, +1024 Mastery, +20134 Int }, relics: { +55 ilevels, +55 ilevels, +55 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="T19 2pc - T20 4pc"
spec=destruction
level=110
race=troll
role=spell
position=back
talents=1203012
artifact=38:0:0:0:0:803:1:804:4:805:4:806:4:807:4:808:4:809:4:810:4:811:4:812:4:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1612:1:1713:1

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
actions+=/havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/cataclysm,if=spell_targets.cataclysm>=3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
actions+=/immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/use_items
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest,if=!buff.soul_harvest.remains
actions+=/chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
actions+=/rain_of_fire,if=active_enemies>=3
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=active_enemies<3&target.time_to_die<=10
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=diabolic_helm,id=147183,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant_id=5437
shoulders=lessons_of_spacetime,id=144369,ilevel=970
back=diabolic_shroud,id=147181,ilevel=930,enchant_id=5436
chest=diabolic_robe,id=147185,ilevel=930
wrists=oathbreakers_cuffs,id=147001,ilevel=930
hands=gloves_of_furtive_oppression,id=146988,ilevel=930
waist=feretory_of_souls,id=132456,ilevel=970
legs=diabolic_leggings,id=147184,ilevel=930
feet=slippers_of_enduring_vigilance,id=146987,ilevel=930
finger1=yathaes_thumb_ring,id=147021,ilevel=930,enchant_id=5428
finger2=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant_id=5428
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=scepter_of_sargeras,id=128941,ilevel=957,gem_id=147087/147090/147087

# Gear Summary
# gear_ilvl=938.47
# gear_stamina=46630
# gear_intellect=49413
# gear_crit_rating=7369
# gear_haste_rating=10264
# gear_mastery_rating=6681
# gear_versatility_rating=3849
# gear_armor=2233
# set_bonus=tier19_2pc=1
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1
default_pet=imp

T19 4pc : 1345969 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1345969.4 1345969.4 2095.7 / 0.156% 203630.7 / 15.1% 41.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
24510.7 24510.7 Mana 0.00% 50.0 100.0% 100%
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Channel Demonfire (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T19 4pc 1345969
Channel Demonfire 0 (162171) 0.0% (12.1%) 16.1 19.06sec 3026360 1249302

Stats details: channel_demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.09 0.00 240.64 0.00 2.4225 0.1453 0.00 0.00 0.00 1249302.07 1249302.07
 
 

Action details: channel_demonfire

Static Values
  • id:196447
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:52800.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
Spelldata
  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Channel Demonfire (_tick) 162171 12.1% 0.0 0.00sec 0 0 Direct 235.7 165649 331275 206650 24.8%  

Stats details: channel_demonfire_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 235.70 0.00 0.00 0.0000 0.0000 48707788.99 48707788.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.36 75.25% 165649.00 120067 242674 165849.16 155699 181597 29379270 29379270 0.00
crit 58.35 24.75% 331274.52 240137 485345 331701.17 308666 376360 19328519 19328519 0.00
 
 

Action details: channel_demonfire_tick

Static Values
  • id:196448
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Chaos Bolt 346924 25.8% 40.5 7.32sec 2575503 1720886 Direct 41.3 0 2523963 2523963 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.49 41.32 0.00 0.00 1.4966 0.0000 104285711.92 104285711.92 0.00 1720886.34 1720886.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 41.32 100.00% 2523963.14 1825708 3764098 2524993.10 2386895 2684433 104285712 104285712 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=1}} Chaos damage. Damage is further increased by your critical strike chance.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 131568 9.8% 42.9 7.05sec 921132 844087 Direct 42.9 492068 1186097 921173 61.8%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.92 42.92 0.00 0.00 1.0913 0.0000 39534515.09 39534515.09 0.00 844087.26 844087.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.39 38.18% 492067.63 359066 725717 492426.59 426828 550706 8063020 8063020 0.00
crit 26.53 61.82% 1186096.62 718308 1827280 1186936.12 1064168 1331213 31471496 31471496 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 6654 0.5% 14.0 2.12sec 140420 0 Direct 14.0 112906 225487 140426 24.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.00 14.00 0.00 0.00 0.0000 0.0000 1965380.15 1965380.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.58 75.56% 112906.07 98855 130488 112932.55 98855 126139 1194090 1194090 0.00
crit 3.42 24.44% 225487.24 197709 260976 220066.71 0 260976 771290 771290 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 109656 8.2% 17.2 17.92sec 1918100 1715832 Direct 17.2 268877 535750 422214 57.5%  
Periodic 136.3 119947 239513 188856 57.6% 98.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.20 17.20 136.26 136.26 1.1179 2.1827 32997159.62 32997159.62 0.00 104205.07 1715831.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.32 42.54% 268876.82 198330 399556 268900.84 0 318687 1967707 1967707 0.00
crit 9.88 57.46% 535749.95 396636 800192 535923.39 464805 609706 5295725 5295725 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.7 42.37% 119946.64 113 179428 120025.18 112877 129096 6924677 6924677 0.00
crit 78.5 57.63% 239512.76 178 358847 239676.74 225568 253560 18809051 18809051 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 180342 13.4% 98.2 2.98sec 552878 490834 Direct 97.8 441702 881212 555316 25.8%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.20 97.76 0.00 0.00 1.1264 0.0000 54290118.58 54290118.58 0.00 490833.56 490833.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.49 74.15% 441701.84 330249 667495 442051.32 418974 468696 32020517 32020517 0.00
crit 25.27 25.85% 881211.71 660498 1334679 881752.74 814588 990100 22269602 22269602 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:55000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.84
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Insidious Corruption 13630 1.0% 5.1 60.51sec 807361 0 Periodic 42.8 77185 154042 95809 24.2% 19.8%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.08 0.00 42.83 42.83 0.0000 1.3956 4103086.42 4103086.42 0.00 68651.37 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.4 75.77% 77184.51 1309 94095 77166.95 72175 82789 2504478 2504478 0.00
crit 10.4 24.23% 154041.91 2618 188191 153944.74 105423 172508 1598608 1598608 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Spectral Owl 0 (73716) 0.0% (5.5%) 3.0 120.42sec 7316091 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 0.00 57.47 0.00 0.0000 1.0000 0.00 0.00 0.00 383661.76 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 22841 1.7% 33.2 7.96sec 205532 0 Direct 33.0 166676 333153 206867 24.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.24 33.02 0.00 0.00 0.0000 0.0000 6831109.55 6831109.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.05 75.85% 166676.00 138719 183108 166723.32 155365 180761 4174847 4174847 0.00
crit 7.97 24.15% 333152.98 277437 366217 333061.17 0 366217 2656262 2656262 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
    Spectral Bolt 50874 3.8% 85.8 3.03sec 177268 0 Direct 85.5 143293 286341 178006 24.3%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.84 85.48 0.00 0.00 0.0000 0.0000 15216780.82 15216780.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.74 75.73% 143292.83 118901 156949 143314.84 137356 150921 9276676 9276676 0.00
crit 20.75 24.27% 286341.21 237802 313898 286331.24 261582 310821 5940105 5940105 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90466.53
  • base_dd_max:99989.32
 
pet - infernal 109135 / 1170
Immolation 45973 0.0% 1.0 0.00sec 145747 0 Periodic 2.0 58287 116514 72867 25.1% 0.9%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 2.00 2.00 0.0000 1.3635 145746.51 145746.51 0.00 53465.34 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.5 74.95% 58287.34 57050 60799 54605.21 0 60799 87372 87372 0.00
crit 0.5 25.05% 116513.51 114100 121599 51025.47 0 121599 58374 58374 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 27464 0.0% 2.0 1.19sec 43496 31726 Direct 2.0 34899 69773 43506 24.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.3714 0.0000 86991.33 127885.50 31.98 31725.50 31725.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.51 75.35% 34898.90 34116 36358 32717.32 0 36358 52592 77315 29.98
crit 0.49 24.65% 69772.79 68232 72716 30042.17 0 72716 34399 50570 13.77
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Meteor Strike 35699 0.0% 1.0 0.00sec 112977 0 Direct 1.0 89646 179407 112984 26.0%  

Stats details: meteor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 112976.84 112976.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.74 74.01% 89646.09 87769 93537 66345.20 0 93537 66345 66345 0.00
crit 0.26 25.99% 179407.30 175538 187075 46631.64 0 187075 46632 46632 0.00
 
 

Action details: meteor_strike

Static Values
  • id:171018
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time>1
Spelldata
  • id:171018
  • name:Meteor Strike
  • school:fire
  • tooltip:Stunned.
  • description:The abyssal releases a powerful burst of flames, dealing {$s1=0} Fire damage to nearby targets, and stunning them for {$d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - doomguard 155463 / 153770
Doom Bolt 155463 11.5% 134.3 2.22sec 344584 155904 Direct 133.5 276340 550874 346569 25.6%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.32 133.55 0.00 0.00 2.2102 0.0000 46282899.42 46282899.42 0.00 155904.49 155904.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.39 74.42% 276339.74 240339 406790 276482.96 265842 291893 27464715 27464715 0.00
crit 34.16 25.58% 550874.47 480678 813580 551083.08 516657 596343 18818184 18818184 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 330035 / 27917
Immolation 206476 1.3% 3.0 0.00sec 1720703 0 Periodic 66.0 62949 125894 78216 24.3% 24.5%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 66.00 66.00 0.0000 1.1193 5162108.75 5162108.75 0.00 69879.10 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.0 75.75% 62949.46 51863 72959 62949.54 58649 68465 3147053 3147053 0.00
crit 16.0 24.25% 125893.97 103727 145918 125911.29 111459 143892 2015056 2015056 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 123559 0.8% 66.0 1.12sec 46804 41817 Direct 66.0 37687 75369 46803 24.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.00 66.00 0.00 0.00 1.1193 0.0000 3089096.08 4541263.85 31.98 41816.87 41816.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.03 75.81% 37687.38 31015 43630 37686.85 35255 40770 1885542 2771925 31.98
crit 15.97 24.19% 75368.82 62029 87260 75369.21 66164 85722 1203554 1769339 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 174172 / 25944
Shadow Bolt 174172 1.9% 3.6 68.24sec 2163050 0 Periodic 36.1 172286 343321 215441 25.2% 16.3%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.59 0.00 36.24 36.05 0.0000 1.3517 7766793.92 7766793.92 0.00 158541.59 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.0 74.76% 172286.34 676 224492 171806.38 0 218369 4643653 4643653 0.00
crit 9.1 25.24% 343320.55 2555 448983 340995.29 0 448983 3123141 3123141 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 238924 / 70348
Searing Bolt 238924 5.2% 70.5 2.63sec 296660 821206 Direct 70.0 90719 0 90719 0.0%  
Periodic 110.3 105213 210305 131970 25.5% 36.0%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.46 70.00 110.28 110.28 0.3613 0.9848 20902983.89 20902983.89 0.00 155928.42 821206.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.00 100.00% 90719.45 76514 112247 90696.76 0 112247 6349863 6349863 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.2 74.54% 105212.75 1030 157176 104942.48 0 133020 8648656 8648656 0.00
crit 28.1 25.46% 210304.81 4022 314352 209568.41 0 285642 5904465 5904465 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=20 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.070000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 368293 / 21678
Chaos Bolt 368293 1.6% 3.6 68.37sec 1803209 810449 Direct 3.6 0 1813685 1813685 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.61 3.59 0.00 0.00 2.2250 0.0000 6515201.00 6515201.00 0.00 810449.19 810449.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.59 100.00% 1813685.18 1662034 2261471 1812379.95 0 2261471 6515201 6515201 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:8.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 369968 / 23357
Chaos Barrage 369968 1.7% 3.6 66.36sec 1946406 0 Periodic 112.1 49819 99354 62406 25.4% 6.5%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.59 0.00 112.61 112.05 0.0000 0.1737 6992760.10 6992760.10 0.00 357429.98 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.6 74.59% 49818.51 249 61736 49717.27 44287 61736 4163448 4163448 0.00
crit 28.5 25.41% 99354.17 975 123473 99253.27 80557 123473 2829312 2829312 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
T19 4pc
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 4pc
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.51sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 14.1 22.97sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.08 0.00 0.00 0.00 1.1173 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target. |cFFFFFFFFGenerates {$s2=3} Soul Shard Fragments.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 4pc
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 4pc
  • harmful:false
  • if_expr:
 
Life Tap 6.3 35.38sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.31 0.00 0.00 0.00 1.1577 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 3.0 121.18sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.soul_harvest.remains
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7763 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Backdraft 37.2 5.7 8.2sec 7.1sec 58.35% 49.36% 0.0(0.0) 1.6

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:17.86%
  • backdraft_2:35.09%
  • backdraft_3:2.66%
  • backdraft_4:2.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Berserking 2.1 0.0 180.5sec 180.5sec 6.89% 10.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.4 3.1 35.4sec 25.0sec 32.34% 32.34% 3.1(3.1) 8.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagration of Chaos 21.4 0.0 14.0sec 14.0sec 52.41% 48.71% 0.0(0.0) 0.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:52.41%

Trigger Attempt Success

  • trigger_pct:49.98%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a {$h=50}% chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Embrace Chaos 28.2 13.3 10.9sec 7.3sec 47.04% 48.34% 13.3(13.3) 27.6

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:47.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.2sec 60.2sec 19.13% 19.13% 0.0(0.0) 4.7

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lessons of Space-Time 10.6 3.5 29.3sec 23.1sec 39.02% 39.02% 3.5(3.5) 10.3

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_lessons_of_spacetime
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • lessons_of_spacetime_1:39.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:236176
  • name:Lessons of Space-Time
  • tooltip:You and your minions deal {$s1=10}% increased damage.
  • description:{$@spelldesc236174=While you have a Dimensional Rift open, all of your damage is increased by {$236176s1=10}%.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 99.63% 99.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.1 4.2 22.9sec 17.1sec 30.11% 30.11% 4.2(4.2) 12.8

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.15% 10.15% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.62% 19.62% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 3.0 0.0 121.2sec 121.2sec 13.45% 100.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • soul_harvest_1:13.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.5 68.1sec
flame_rift 3.5 69.0sec
chaos_tear 3.5 68.0sec
chaos_portal 3.5 68.2sec
dimension_ripper 4.9 48.2sec
t19_2pc_chaos_bolt 17.4 17.1sec

Resources

Resource Usage Type Count Total Average RPE APR
T19 4pc
channel_demonfire Mana 29.3 1549570.2 52800.0 96279.4 31.4
chaos_bolt Soul Shard 75.7 151.3 2.0 3.7 689205.6
immolate Mana 31.4 2070310.7 66000.0 120345.6 15.9
incinerate Mana 179.1 9848369.8 55000.0 100293.6 5.5
summon_doomguard Soul Shard 1.8 1.8 1.0 1.8 0.0
pet - doomguard
doom_bolt Energy 134.3 4701.0 35.0 35.0 9845.3
pet - flame_rift
searing_bolt Energy 69.1 69.1 1.0 1.0 302680.3
Resource Gains Type Count Total Average Overflow
life_tap Mana 11.51 3799212.25 (31.99%) 330000.00 0.00 0.00%
immolate Soul Shard 248.47 23.74 (15.78%) 0.10 1.11 4.46%
dimensional_rift Soul Shard 25.67 7.43 (4.94%) 0.29 0.27 3.48%
conflagrate Soul Shard 78.26 38.53 (25.61%) 0.49 0.60 1.53%
incinerate Soul Shard 179.06 35.45 (23.56%) 0.20 0.37 1.02%
mp5_regen Mana 1412.78 8077176.19 (68.01%) 5717.24 136177.03 1.66%
immolate_crits Soul Shard 71.67 6.87 (4.57%) 0.10 0.29 4.08%
soulsnatcher Soul Shard 11.43 11.43 (7.59%) 1.00 0.00 0.00%
feretory_of_souls Soul Shard 23.69 22.45 (14.92%) 0.95 1.24 5.25%
incinerate_crits Soul Shard 46.30 4.57 (3.04%) 0.10 0.06 1.26%
pet - doomguard
energy_regen Energy 244.92 8508.35 (100.00%) 34.74 284.02 3.23%
Resource RPS-Gain RPS-Loss
Health 0.00 9540.29
Mana 21613.33 24510.67
Soul Shard 0.27 0.28
Combat End Resource Mean Min Max
Mana 225911.90 13415.98 481576.44
Soul Shard 1.54 0.00 4.30

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.9%

Statistics & Data Analysis

Fight Length
Sample Data T19 4pc Fight Length
Count 2497
Mean 301.34
Minimum 213.15
Maximum 407.18
Spread ( max - min ) 194.04
Range [ ( max - min ) / 2 * 100% ] 32.20%
Standard Deviation 41.4678
5th Percentile 239.55
95th Percentile 367.15
( 95th Percentile - 5th Percentile ) 127.60
Mean Distribution
Standard Deviation 0.8299
95.00% Confidence Intervall ( 299.71 - 302.96 )
Normalized 95.00% Confidence Intervall ( 99.46% - 100.54% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 728
0.1% Error 72748
0.1 Scale Factor Error with Delta=300 15
0.05 Scale Factor Error with Delta=300 59
0.01 Scale Factor Error with Delta=300 1468
DPS
Sample Data T19 4pc Damage Per Second
Count 2497
Mean 1345969.40
Minimum 1142198.71
Maximum 1584274.15
Spread ( max - min ) 442075.44
Range [ ( max - min ) / 2 * 100% ] 16.42%
Standard Deviation 53429.5861
5th Percentile 1263718.27
95th Percentile 1436807.60
( 95th Percentile - 5th Percentile ) 173089.32
Mean Distribution
Standard Deviation 1069.2335
95.00% Confidence Intervall ( 1343873.74 - 1348065.06 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6054
0.1 Scale Factor Error with Delta=300 24369538
0.05 Scale Factor Error with Delta=300 97478151
0.01 Scale Factor Error with Delta=300 2436953755
Priority Target DPS
Sample Data T19 4pc Priority Target Damage Per Second
Count 2497
Mean 1345969.40
Minimum 1142198.71
Maximum 1584274.15
Spread ( max - min ) 442075.44
Range [ ( max - min ) / 2 * 100% ] 16.42%
Standard Deviation 53429.5861
5th Percentile 1263718.27
95th Percentile 1436807.60
( 95th Percentile - 5th Percentile ) 173089.32
Mean Distribution
Standard Deviation 1069.2335
95.00% Confidence Intervall ( 1343873.74 - 1348065.06 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6054
0.1 Scale Factor Error with Delta=300 24369538
0.05 Scale Factor Error with Delta=300 97478151
0.01 Scale Factor Error with Delta=300 2436953755
DPS(e)
Sample Data T19 4pc Damage Per Second (Effective)
Count 2497
Mean 1345969.40
Minimum 1142198.71
Maximum 1584274.15
Spread ( max - min ) 442075.44
Range [ ( max - min ) / 2 * 100% ] 16.42%
Damage
Sample Data T19 4pc Damage
Count 2497
Mean 307931651.13
Minimum 228059317.18
Maximum 385300254.72
Spread ( max - min ) 157240937.55
Range [ ( max - min ) / 2 * 100% ] 25.53%
DTPS
Sample Data T19 4pc Damage Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T19 4pc Healing Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T19 4pc Healing Per Second (Effective)
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T19 4pc Heal
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T19 4pc Healing Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T19 4pc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data T19 4pcTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T19 4pc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
0.00 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
C 1.11 dimensional_rift,if=charges=3
0.00 cataclysm,if=spell_targets.cataclysm>=3
D 5.83 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
0.00 immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
E 2.08 berserking
0.00 blood_fury
F 8.10 use_items
G 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
H 22.02 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
I 0.44 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
J 1.15 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
0.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
K 1.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
L 2.97 soul_harvest,if=!buff.soul_harvest.remains
0.00 chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
M 16.09 channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
0.00 rain_of_fire,if=active_enemies>=3
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
N 11.81 dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
O 1.86 chaos_bolt,if=active_enemies<3&target.time_to_die<=10
P 38.79 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
0.00 shadowburn
Q 20.46 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
R 11.44 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
S 98.51 incinerate
T 6.31 life_tap

Sample Sequence

0136ABCDEFHHKLMNSPHQPSSQSSPRSMQSSFSSQSPSSSQPMRQPSSNPSPQNSSSSHMDSSHPSSSSHSPRSMHSSPSQFSTSSPDHMNHPPSSSNHPRSSSMQSPSNPFQPLGRSHPSTSMHNSSSPFQDPSSSQSMSPHRSTSSQPSSSMPPPDNEQHPSPSSQMSNRHSSSPSFQTSSSMPQDSSQPSSSNHPMRSHSTSSPFPPJLPQMDPPQSPHSSSNFSQRSMNOHOSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T19 4pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food T19 4pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_infernal Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation T19 4pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:00.000 default C dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:01.173 default D immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.3/5: 26% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:02.075 default E berserking Fluffy_Pillow 1034073.4/1100000: 94% mana | 1.3/5: 26% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:02.075 default F use_items Fluffy_Pillow 1034073.4/1100000: 94% mana | 1.3/5: 26% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:02.075 default H conflagrate Fluffy_Pillow 1034073.4/1100000: 94% mana | 1.3/5: 26% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:02.861 default H conflagrate Fluffy_Pillow 1050666.3/1100000: 96% mana | 1.8/5: 36% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:03.649 default K summon_doomguard Fluffy_Pillow 1067301.4/1100000: 97% mana | 2.3/5: 46% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(4), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:04.434 default L soul_harvest Fluffy_Pillow 1083873.2/1100000: 99% mana | 1.4/5: 28% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(4), lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:04.434 default M channel_demonfire Fluffy_Pillow 1083873.2/1100000: 99% mana | 1.4/5: 28% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.135 default N dimensional_rift Fluffy_Pillow 1067089.7/1100000: 97% mana | 1.5/5: 30% soul_shard bloodlust, berserking, soul_harvest, backdraft(4), lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.905 default S incinerate Fluffy_Pillow 1083682.5/1100000: 99% mana | 1.8/5: 36% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.660 default P chaos_bolt Fluffy_Pillow 1044952.1/1100000: 95% mana | 2.1/5: 42% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(3), lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:08.737 default H conflagrate Fluffy_Pillow 1068160.5/1100000: 97% mana | 0.2/5: 4% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:09.506 default Q conflagrate Fluffy_Pillow 1084731.7/1100000: 99% mana | 1.7/5: 34% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:10.274 default P chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.3/5: 46% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:11.029 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.3/5: 6% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(3), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:11.782 default S incinerate Fluffy_Pillow 1047068.7/1100000: 95% mana | 0.6/5: 12% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:12.536 default Q conflagrate Fluffy_Pillow 1007021.0/1100000: 92% mana | 0.9/5: 18% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:13.443 default S incinerate Fluffy_Pillow 1024016.6/1100000: 93% mana | 1.6/5: 32% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft(3), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:14.203 default S incinerate Fluffy_Pillow 983257.8/1100000: 89% mana | 1.9/5: 38% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:14.964 default P chaos_bolt Fluffy_Pillow 942517.7/1100000: 86% mana | 2.2/5: 44% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:16.200 default R immolate Fluffy_Pillow 965678.2/1100000: 88% mana | 0.2/5: 4% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:17.085 default S incinerate Fluffy_Pillow 916261.7/1100000: 83% mana | 0.4/5: 8% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:18.168 default M channel_demonfire Fluffy_Pillow 881555.3/1100000: 80% mana | 1.6/5: 32% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:20.264 default Q conflagrate Fluffy_Pillow 868030.9/1100000: 79% mana | 1.9/5: 38% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:21.148 default S incinerate Fluffy_Pillow 884493.0/1100000: 80% mana | 2.4/5: 48% soul_shard bloodlust, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:21.923 default S incinerate Fluffy_Pillow 843719.6/1100000: 77% mana | 2.7/5: 54% soul_shard bloodlust, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:22.699 default F use_items Fluffy_Pillow 802964.7/1100000: 73% mana | 2.9/5: 58% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:22.699 default S incinerate Fluffy_Pillow 802964.7/1100000: 73% mana | 2.9/5: 58% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:23.807 default S incinerate Fluffy_Pillow 768337.4/1100000: 70% mana | 3.3/5: 66% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:24.891 default Q conflagrate Fluffy_Pillow 733649.8/1100000: 67% mana | 3.5/5: 70% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:25.778 default S incinerate Fluffy_Pillow 750270.7/1100000: 68% mana | 4.2/5: 84% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:26.539 default P chaos_bolt Fluffy_Pillow 709530.6/1100000: 65% mana | 4.5/5: 90% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:27.774 default S incinerate Fluffy_Pillow 732672.4/1100000: 67% mana | 2.6/5: 52% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:28.861 default S incinerate Fluffy_Pillow 698041.0/1100000: 63% mana | 2.8/5: 56% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:29.945 default S incinerate Fluffy_Pillow 663267.5/1100000: 60% mana | 3.3/5: 66% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:31.053 default Q conflagrate Fluffy_Pillow 628607.1/1100000: 57% mana | 3.6/5: 72% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:31.956 default P chaos_bolt Fluffy_Pillow 645183.5/1100000: 59% mana | 5.0/5: 100% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:33.219 default M channel_demonfire Fluffy_Pillow 668368.4/1100000: 61% mana | 3.0/5: 60% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:35.337 default R immolate Fluffy_Pillow 654448.5/1100000: 59% mana | 3.1/5: 62% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:36.240 default Q conflagrate Fluffy_Pillow 605024.9/1100000: 55% mana | 4.2/5: 84% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:37.141 default P chaos_bolt Fluffy_Pillow 621564.6/1100000: 57% mana | 4.7/5: 94% soul_shard bloodlust, backdraft(3), lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:37.900 default S incinerate Fluffy_Pillow 635497.5/1100000: 58% mana | 2.7/5: 54% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:38.675 default S incinerate Fluffy_Pillow 594724.2/1100000: 54% mana | 3.1/5: 62% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:39.450 default N dimensional_rift Fluffy_Pillow 553950.9/1100000: 50% mana | 3.4/5: 68% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:40.352 default P chaos_bolt Fluffy_Pillow 570508.9/1100000: 52% mana | 3.8/5: 76% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:41.433 default S incinerate Fluffy_Pillow 585773.5/1100000: 53% mana | 1.8/5: 36% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:42.870 default P chaos_bolt Fluffy_Pillow 551065.0/1100000: 50% mana | 2.1/5: 42% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:44.275 default Q conflagrate Fluffy_Pillow 570904.7/1100000: 52% mana | 0.3/5: 6% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:45.447 default N dimensional_rift Fluffy_Pillow 587454.2/1100000: 53% mana | 0.8/5: 16% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:46.621 default S incinerate Fluffy_Pillow 604032.0/1100000: 55% mana | 1.2/5: 24% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:47.630 default S incinerate Fluffy_Pillow 563279.9/1100000: 51% mana | 1.4/5: 28% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.638 default S incinerate Fluffy_Pillow 522513.6/1100000: 48% mana | 1.7/5: 34% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.076 default S incinerate Fluffy_Pillow 487819.3/1100000: 44% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, potion_of_prolonged_power
0:51.513 default H conflagrate Fluffy_Pillow 453110.8/1100000: 41% mana | 2.4/5: 48% soul_shard lessons_of_spacetime, lord_of_flames, potion_of_prolonged_power
0:52.686 default M channel_demonfire Fluffy_Pillow 469674.5/1100000: 43% mana | 2.9/5: 58% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:55.177 default D immolate Fluffy_Pillow 452734.6/1100000: 41% mana | 3.1/5: 62% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw, potion_of_prolonged_power
0:56.326 default S incinerate Fluffy_Pillow 403296.4/1100000: 37% mana | 3.4/5: 68% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw, potion_of_prolonged_power
0:57.312 default S incinerate Fluffy_Pillow 362508.7/1100000: 33% mana | 3.7/5: 74% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, mark_of_the_claw, potion_of_prolonged_power
0:58.298 default H conflagrate Fluffy_Pillow 321721.0/1100000: 29% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
0:59.446 default P chaos_bolt Fluffy_Pillow 338090.9/1100000: 31% mana | 4.6/5: 92% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
1:01.086 default S incinerate Fluffy_Pillow 361249.0/1100000: 33% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos
1:02.095 default S incinerate Fluffy_Pillow 320498.6/1100000: 29% mana | 2.9/5: 58% soul_shard lord_of_flames, embrace_chaos, mark_of_the_claw
1:03.502 default S incinerate Fluffy_Pillow 285779.3/1100000: 26% mana | 3.3/5: 66% soul_shard lord_of_flames, embrace_chaos, mark_of_the_claw
1:04.910 default S incinerate Fluffy_Pillow 251074.3/1100000: 23% mana | 3.6/5: 72% soul_shard lord_of_flames, embrace_chaos, mark_of_the_claw
1:06.318 default H conflagrate Fluffy_Pillow 216369.4/1100000: 20% mana | 3.9/5: 78% soul_shard lord_of_flames, mark_of_the_claw
1:07.467 default S incinerate Fluffy_Pillow 232931.2/1100000: 21% mana | 4.4/5: 88% soul_shard backdraft(2), lord_of_flames, mark_of_the_claw
1:08.454 default P chaos_bolt Fluffy_Pillow 192050.9/1100000: 17% mana | 4.9/5: 98% soul_shard backdraft, lord_of_flames
1:10.093 default R immolate Fluffy_Pillow 215196.0/1100000: 20% mana | 2.9/5: 58% soul_shard lord_of_flames, embrace_chaos, mark_of_the_claw
1:11.242 default S incinerate Fluffy_Pillow 165757.8/1100000: 15% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, mark_of_the_claw
1:12.650 default M channel_demonfire Fluffy_Pillow 131052.9/1100000: 12% mana | 3.4/5: 68% soul_shard lord_of_flames, embrace_chaos, mark_of_the_claw
1:15.243 default H conflagrate Fluffy_Pillow 115628.6/1100000: 11% mana | 3.5/5: 70% soul_shard lord_of_flames, mark_of_the_claw
1:16.392 default S incinerate Fluffy_Pillow 132101.6/1100000: 12% mana | 4.0/5: 80% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
1:17.399 default S incinerate Fluffy_Pillow 91321.2/1100000: 8% mana | 4.4/5: 88% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
1:18.407 default P chaos_bolt Fluffy_Pillow 50554.9/1100000: 5% mana | 4.7/5: 94% soul_shard lord_of_flames, conflagration_of_chaos
1:20.748 default S incinerate Fluffy_Pillow 83611.7/1100000: 8% mana | 2.8/5: 56% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:22.185 default Q conflagrate Fluffy_Pillow 48903.2/1100000: 4% mana | 3.2/5: 64% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:23.360 default F use_items Fluffy_Pillow 65495.1/1100000: 6% mana | 3.7/5: 74% soul_shard backdraft(2), lord_of_flames, embrace_chaos
1:23.360 default S incinerate Fluffy_Pillow 65495.1/1100000: 6% mana | 3.7/5: 74% soul_shard backdraft(2), lord_of_flames, embrace_chaos
1:24.367 default T life_tap Fluffy_Pillow 24829.1/1100000: 2% mana | 4.1/5: 82% soul_shard backdraft, lord_of_flames, embrace_chaos, mark_of_the_claw
1:25.515 default S incinerate Fluffy_Pillow 371376.5/1100000: 34% mana | 4.1/5: 82% soul_shard backdraft, lord_of_flames, mark_of_the_claw
1:26.503 default S incinerate Fluffy_Pillow 330617.7/1100000: 30% mana | 4.4/5: 88% soul_shard lord_of_flames, mark_of_the_claw
1:27.911 default P chaos_bolt Fluffy_Pillow 295912.7/1100000: 27% mana | 4.6/5: 92% soul_shard lord_of_flames, mark_of_the_claw
1:30.204 default D immolate Fluffy_Pillow 328897.7/1100000: 30% mana | 2.7/5: 54% soul_shard lord_of_flames, embrace_chaos
1:31.375 default H conflagrate Fluffy_Pillow 279433.1/1100000: 25% mana | 2.8/5: 56% soul_shard lord_of_flames, embrace_chaos
1:32.547 default M channel_demonfire Fluffy_Pillow 296049.0/1100000: 27% mana | 3.5/5: 70% soul_shard backdraft(2), lord_of_flames, embrace_chaos, mark_of_the_claw
1:35.053 default N dimensional_rift Fluffy_Pillow 279370.7/1100000: 25% mana | 3.6/5: 72% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
1:36.198 default H conflagrate Fluffy_Pillow 295874.9/1100000: 27% mana | 3.9/5: 78% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:37.535 default P chaos_bolt Fluffy_Pillow 315146.5/1100000: 29% mana | 4.5/5: 90% soul_shard lessons_of_spacetime, backdraft(4), lord_of_flames, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:39.142 default P chaos_bolt Fluffy_Pillow 338069.2/1100000: 31% mana | 2.5/5: 50% soul_shard lessons_of_spacetime, backdraft(3), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
1:40.127 default S incinerate Fluffy_Pillow 351978.1/1100000: 32% mana | 0.6/5: 12% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
1:41.134 default S incinerate Fluffy_Pillow 311197.7/1100000: 28% mana | 0.8/5: 16% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
1:42.139 default S incinerate Fluffy_Pillow 270389.1/1100000: 25% mana | 1.3/5: 26% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
1:43.578 default N dimensional_rift Fluffy_Pillow 235708.9/1100000: 21% mana | 1.6/5: 32% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
1:44.749 default H conflagrate Fluffy_Pillow 252244.3/1100000: 23% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, extracted_sanity
1:45.921 default P chaos_bolt Fluffy_Pillow 268793.9/1100000: 24% mana | 2.5/5: 50% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
1:47.561 default R immolate Fluffy_Pillow 292338.6/1100000: 27% mana | 0.7/5: 14% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:48.710 default S incinerate Fluffy_Pillow 242900.4/1100000: 22% mana | 0.8/5: 16% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:49.696 default S incinerate Fluffy_Pillow 202112.7/1100000: 18% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:51.105 default S incinerate Fluffy_Pillow 167422.2/1100000: 15% mana | 1.3/5: 26% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:52.514 default M channel_demonfire Fluffy_Pillow 132652.1/1100000: 12% mana | 1.5/5: 30% soul_shard lord_of_flames, conflagration_of_chaos
1:55.134 default Q conflagrate Fluffy_Pillow 116848.6/1100000: 11% mana | 1.8/5: 36% soul_shard lord_of_flames, conflagration_of_chaos
1:56.307 default S incinerate Fluffy_Pillow 133412.2/1100000: 12% mana | 2.3/5: 46% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
1:57.314 default P chaos_bolt Fluffy_Pillow 92631.9/1100000: 8% mana | 2.7/5: 54% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
1:58.954 default S incinerate Fluffy_Pillow 115789.9/1100000: 11% mana | 1.7/5: 34% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
2:00.390 default N dimensional_rift Fluffy_Pillow 81067.4/1100000: 7% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
2:01.563 default P chaos_bolt Fluffy_Pillow 97631.0/1100000: 9% mana | 2.3/5: 46% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
2:02.969 default F use_items Fluffy_Pillow 117484.8/1100000: 11% mana | 0.5/5: 10% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
2:02.969 default Q conflagrate Fluffy_Pillow 117484.8/1100000: 11% mana | 0.5/5: 10% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
2:04.140 default P chaos_bolt Fluffy_Pillow 134020.3/1100000: 12% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall
2:05.127 default L soul_harvest Fluffy_Pillow 147957.5/1100000: 13% mana | 0.1/5: 2% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall
2:05.127 default G potion Fluffy_Pillow 147957.5/1100000: 13% mana | 0.1/5: 2% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall
2:05.127 default R immolate Fluffy_Pillow 147957.5/1100000: 13% mana | 0.1/5: 2% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:06.301 default S incinerate Fluffy_Pillow 98535.2/1100000: 9% mana | 0.1/5: 2% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:07.310 default H conflagrate Fluffy_Pillow 57783.1/1100000: 5% mana | 1.5/5: 30% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:08.482 default P chaos_bolt Fluffy_Pillow 74332.6/1100000: 7% mana | 2.0/5: 40% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:09.468 default S incinerate Fluffy_Pillow 88255.7/1100000: 8% mana | 1.1/5: 22% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:10.475 default T life_tap Fluffy_Pillow 47475.3/1100000: 4% mana | 1.3/5: 26% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:11.647 default S incinerate Fluffy_Pillow 394024.9/1100000: 36% mana | 1.4/5: 28% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:13.085 default M channel_demonfire Fluffy_Pillow 359330.6/1100000: 33% mana | 1.6/5: 32% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_deadly_grace
2:15.704 default H conflagrate Fluffy_Pillow 343512.9/1100000: 31% mana | 1.7/5: 34% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, potion_of_deadly_grace
2:16.873 default N dimensional_rift Fluffy_Pillow 360020.1/1100000: 33% mana | 3.4/5: 68% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:18.047 default S incinerate Fluffy_Pillow 376597.8/1100000: 34% mana | 3.7/5: 74% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:19.054 default S incinerate Fluffy_Pillow 335817.5/1100000: 31% mana | 4.1/5: 82% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:20.063 default S incinerate Fluffy_Pillow 295067.1/1100000: 27% mana | 4.4/5: 88% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_deadly_grace
2:21.471 default P chaos_bolt Fluffy_Pillow 260362.1/1100000: 24% mana | 4.8/5: 96% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_deadly_grace
2:23.762 default F use_items Fluffy_Pillow 293384.9/1100000: 27% mana | 2.9/5: 58% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw, potion_of_deadly_grace
2:23.762 default Q conflagrate Fluffy_Pillow 293384.9/1100000: 27% mana | 2.9/5: 58% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw, potion_of_deadly_grace
2:24.910 default D immolate Fluffy_Pillow 309932.3/1100000: 28% mana | 4.4/5: 88% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw, potion_of_deadly_grace
2:26.058 default P chaos_bolt Fluffy_Pillow 260479.4/1100000: 24% mana | 4.5/5: 90% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:27.043 default S incinerate Fluffy_Pillow 274388.3/1100000: 25% mana | 2.6/5: 52% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:28.052 default S incinerate Fluffy_Pillow 233636.2/1100000: 21% mana | 2.9/5: 58% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:29.489 default S incinerate Fluffy_Pillow 198927.7/1100000: 18% mana | 3.2/5: 64% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:30.927 default Q conflagrate Fluffy_Pillow 164233.4/1100000: 15% mana | 3.4/5: 68% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:32.099 default S incinerate Fluffy_Pillow 180783.0/1100000: 16% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, potion_of_deadly_grace
2:33.107 default M channel_demonfire Fluffy_Pillow 140016.7/1100000: 13% mana | 4.2/5: 84% soul_shard backdraft, lord_of_flames, potion_of_deadly_grace
2:35.679 default S incinerate Fluffy_Pillow 123535.3/1100000: 11% mana | 4.4/5: 88% soul_shard backdraft, lord_of_flames
2:36.685 default P chaos_bolt Fluffy_Pillow 82740.8/1100000: 8% mana | 4.6/5: 92% soul_shard lord_of_flames, extracted_sanity
2:39.027 default H conflagrate Fluffy_Pillow 115811.7/1100000: 11% mana | 2.7/5: 54% soul_shard lord_of_flames, embrace_chaos, extracted_sanity
2:40.200 default R immolate Fluffy_Pillow 132375.3/1100000: 12% mana | 3.2/5: 64% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
2:41.371 default S incinerate Fluffy_Pillow 82910.8/1100000: 8% mana | 3.3/5: 66% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
2:42.378 default T life_tap Fluffy_Pillow 42130.4/1100000: 4% mana | 3.6/5: 72% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
2:43.552 default S incinerate Fluffy_Pillow 388708.2/1100000: 35% mana | 3.8/5: 76% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
2:44.560 default S incinerate Fluffy_Pillow 347941.9/1100000: 32% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
2:45.997 default Q conflagrate Fluffy_Pillow 313233.5/1100000: 28% mana | 4.4/5: 88% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
2:47.220 default P chaos_bolt Fluffy_Pillow 330503.2/1100000: 30% mana | 4.9/5: 98% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity
2:48.860 default S incinerate Fluffy_Pillow 353661.2/1100000: 32% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
2:49.868 default S incinerate Fluffy_Pillow 312895.0/1100000: 28% mana | 3.3/5: 66% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:51.306 default S incinerate Fluffy_Pillow 278200.6/1100000: 25% mana | 3.5/5: 70% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
2:52.744 default M channel_demonfire Fluffy_Pillow 243719.6/1100000: 22% mana | 3.8/5: 76% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
2:55.244 default P chaos_bolt Fluffy_Pillow 226954.8/1100000: 21% mana | 3.9/5: 78% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
2:57.536 default P chaos_bolt Fluffy_Pillow 259992.0/1100000: 24% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
2:58.914 default P chaos_bolt Fluffy_Pillow 279591.5/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:00.320 default D immolate Fluffy_Pillow 299445.3/1100000: 27% mana | 1.1/5: 22% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:01.490 default N dimensional_rift Fluffy_Pillow 249966.6/1100000: 23% mana | 1.2/5: 24% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:02.662 default E berserking Fluffy_Pillow 266516.1/1100000: 24% mana | 1.6/5: 32% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:02.662 default Q conflagrate Fluffy_Pillow 266516.1/1100000: 24% mana | 1.6/5: 32% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:03.684 default H conflagrate Fluffy_Pillow 283112.3/1100000: 26% mana | 2.1/5: 42% soul_shard berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall
3:04.705 default P chaos_bolt Fluffy_Pillow 299692.2/1100000: 27% mana | 3.8/5: 76% soul_shard berserking, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:06.132 default S incinerate Fluffy_Pillow 322865.1/1100000: 29% mana | 1.8/5: 36% soul_shard berserking, lessons_of_spacetime, backdraft(3), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:07.009 default P chaos_bolt Fluffy_Pillow 282106.6/1100000: 26% mana | 2.1/5: 42% soul_shard berserking, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:07.867 default S incinerate Fluffy_Pillow 296039.6/1100000: 27% mana | 0.1/5: 2% soul_shard berserking, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:08.744 default S incinerate Fluffy_Pillow 255281.1/1100000: 23% mana | 0.4/5: 8% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:09.993 default Q conflagrate Fluffy_Pillow 220563.4/1100000: 20% mana | 0.6/5: 12% soul_shard berserking, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:11.012 default M channel_demonfire Fluffy_Pillow 237110.9/1100000: 22% mana | 2.2/5: 44% soul_shard berserking, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall
3:13.187 default S incinerate Fluffy_Pillow 218518.4/1100000: 20% mana | 2.4/5: 48% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall
3:14.194 default N dimensional_rift Fluffy_Pillow 177738.1/1100000: 16% mana | 2.6/5: 52% soul_shard backdraft, lord_of_flames
3:15.365 default R immolate Fluffy_Pillow 194273.5/1100000: 18% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
3:16.536 default H conflagrate Fluffy_Pillow 144808.9/1100000: 13% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
3:17.707 default S incinerate Fluffy_Pillow 161344.3/1100000: 15% mana | 3.6/5: 72% soul_shard lessons_of_spacetime, backdraft(3), lord_of_flames, conflagration_of_chaos
3:18.714 default S incinerate Fluffy_Pillow 120564.0/1100000: 11% mana | 3.9/5: 78% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos
3:19.721 default S incinerate Fluffy_Pillow 79783.6/1100000: 7% mana | 4.2/5: 84% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos
3:20.729 default P chaos_bolt Fluffy_Pillow 39017.3/1100000: 4% mana | 4.5/5: 90% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
3:23.069 default S incinerate Fluffy_Pillow 72059.9/1100000: 7% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
3:24.506 default F use_items Fluffy_Pillow 37351.5/1100000: 3% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:24.506 default Q conflagrate Fluffy_Pillow 37351.5/1100000: 3% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
3:25.680 default T life_tap Fluffy_Pillow 53929.3/1100000: 5% mana | 3.5/5: 70% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
3:26.853 default S incinerate Fluffy_Pillow 400492.9/1100000: 36% mana | 3.7/5: 74% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
3:27.859 default S incinerate Fluffy_Pillow 359698.4/1100000: 33% mana | 3.9/5: 78% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:28.867 default S incinerate Fluffy_Pillow 318932.2/1100000: 29% mana | 4.2/5: 84% soul_shard lord_of_flames, conflagration_of_chaos
3:30.307 default M channel_demonfire Fluffy_Pillow 284266.1/1100000: 26% mana | 4.5/5: 90% soul_shard lord_of_flames, conflagration_of_chaos
3:32.826 default P chaos_bolt Fluffy_Pillow 267036.3/1100000: 24% mana | 4.6/5: 92% soul_shard lord_of_flames, conflagration_of_chaos
3:35.167 default Q conflagrate Fluffy_Pillow 300094.5/1100000: 27% mana | 2.8/5: 56% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:36.314 default D immolate Fluffy_Pillow 316627.5/1100000: 29% mana | 3.5/5: 70% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:37.464 default S incinerate Fluffy_Pillow 267203.7/1100000: 24% mana | 3.5/5: 70% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, mark_of_the_claw
3:38.451 default S incinerate Fluffy_Pillow 226430.4/1100000: 21% mana | 3.9/5: 78% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, mark_of_the_claw
3:39.439 default Q conflagrate Fluffy_Pillow 185671.6/1100000: 17% mana | 4.1/5: 82% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
3:40.825 default P chaos_bolt Fluffy_Pillow 205649.5/1100000: 19% mana | 4.7/5: 94% soul_shard backdraft(2), lord_of_flames, extracted_sanity, mark_of_the_claw
3:42.431 default S incinerate Fluffy_Pillow 228426.3/1100000: 21% mana | 2.7/5: 54% soul_shard backdraft, lord_of_flames, embrace_chaos, extracted_sanity
3:43.439 default S incinerate Fluffy_Pillow 187660.1/1100000: 17% mana | 3.0/5: 60% soul_shard lord_of_flames, embrace_chaos, extracted_sanity
3:44.878 default S incinerate Fluffy_Pillow 152979.9/1100000: 14% mana | 3.2/5: 64% soul_shard lord_of_flames, embrace_chaos, extracted_sanity
3:46.318 default N dimensional_rift Fluffy_Pillow 118313.8/1100000: 11% mana | 3.5/5: 70% soul_shard lord_of_flames, embrace_chaos, extracted_sanity
3:47.490 default H conflagrate Fluffy_Pillow 134863.3/1100000: 12% mana | 3.8/5: 76% soul_shard lessons_of_spacetime, lord_of_flames, extracted_sanity
3:48.664 default P chaos_bolt Fluffy_Pillow 151441.1/1100000: 14% mana | 4.5/5: 90% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
3:50.304 default M channel_demonfire Fluffy_Pillow 174599.2/1100000: 16% mana | 2.6/5: 52% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos
3:52.834 default R immolate Fluffy_Pillow 157524.7/1100000: 14% mana | 2.8/5: 56% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos
3:54.008 default S incinerate Fluffy_Pillow 108102.5/1100000: 10% mana | 2.8/5: 56% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos
3:55.014 default H conflagrate Fluffy_Pillow 67308.0/1100000: 6% mana | 3.2/5: 64% soul_shard lessons_of_spacetime, lord_of_flames
3:56.395 default S incinerate Fluffy_Pillow 86808.8/1100000: 8% mana | 3.7/5: 74% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:57.403 default T life_tap Fluffy_Pillow 46042.6/1100000: 4% mana | 4.0/5: 80% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:58.576 default S incinerate Fluffy_Pillow 392606.2/1100000: 36% mana | 4.0/5: 80% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:59.584 default S incinerate Fluffy_Pillow 351840.0/1100000: 32% mana | 4.4/5: 88% soul_shard lord_of_flames, conflagration_of_chaos
4:01.021 default P chaos_bolt Fluffy_Pillow 317131.5/1100000: 29% mana | 4.6/5: 92% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:03.362 default F use_items Fluffy_Pillow 350188.2/1100000: 32% mana | 3.7/5: 74% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
4:03.362 default P chaos_bolt Fluffy_Pillow 350188.2/1100000: 32% mana | 3.7/5: 74% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
4:04.767 default P chaos_bolt Fluffy_Pillow 370027.9/1100000: 34% mana | 3.8/5: 76% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
4:06.171 default J dimensional_rift Fluffy_Pillow 389854.4/1100000: 35% mana | 1.8/5: 36% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:07.319 default L soul_harvest Fluffy_Pillow 406401.8/1100000: 37% mana | 2.3/5: 46% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:07.319 default P chaos_bolt Fluffy_Pillow 406401.8/1100000: 37% mana | 2.3/5: 46% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:08.697 default Q conflagrate Fluffy_Pillow 426264.4/1100000: 39% mana | 0.4/5: 8% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:09.845 default M channel_demonfire Fluffy_Pillow 442811.8/1100000: 40% mana | 0.9/5: 18% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:12.260 default D immolate Fluffy_Pillow 424821.9/1100000: 39% mana | 2.0/5: 40% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
4:13.409 default P chaos_bolt Fluffy_Pillow 375383.7/1100000: 34% mana | 3.1/5: 62% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw
4:15.015 default P chaos_bolt Fluffy_Pillow 398532.7/1100000: 36% mana | 3.2/5: 64% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
4:15.982 default Q conflagrate Fluffy_Pillow 412471.2/1100000: 37% mana | 1.2/5: 24% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
4:17.130 default S incinerate Fluffy_Pillow 428909.2/1100000: 39% mana | 1.8/5: 36% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos
4:18.137 default P chaos_bolt Fluffy_Pillow 388128.8/1100000: 35% mana | 2.1/5: 42% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos
4:19.124 default H conflagrate Fluffy_Pillow 402066.0/1100000: 37% mana | 0.2/5: 4% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos
4:20.296 default S incinerate Fluffy_Pillow 418615.5/1100000: 38% mana | 0.7/5: 14% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos
4:21.304 default S incinerate Fluffy_Pillow 377849.3/1100000: 34% mana | 1.0/5: 20% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
4:22.313 default S incinerate Fluffy_Pillow 337097.1/1100000: 31% mana | 1.2/5: 24% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
4:23.750 default N dimensional_rift Fluffy_Pillow 302388.7/1100000: 27% mana | 1.5/5: 30% soul_shard lord_of_flames, conflagration_of_chaos
4:24.922 default F use_items Fluffy_Pillow 318938.2/1100000: 29% mana | 1.8/5: 36% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
4:24.922 default S incinerate Fluffy_Pillow 318938.2/1100000: 29% mana | 1.8/5: 36% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
4:26.359 default Q conflagrate Fluffy_Pillow 284229.8/1100000: 26% mana | 2.1/5: 42% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
4:27.532 default R immolate Fluffy_Pillow 300793.4/1100000: 27% mana | 2.6/5: 52% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
4:28.703 default S incinerate Fluffy_Pillow 251328.9/1100000: 23% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
4:29.711 default M channel_demonfire Fluffy_Pillow 210562.6/1100000: 19% mana | 2.9/5: 58% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
4:32.381 default N dimensional_rift Fluffy_Pillow 195465.1/1100000: 18% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
4:33.554 default O chaos_bolt Fluffy_Pillow 212028.7/1100000: 19% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
4:35.192 default H conflagrate Fluffy_Pillow 235158.6/1100000: 21% mana | 2.5/5: 50% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos
4:36.365 default O chaos_bolt Fluffy_Pillow 251722.2/1100000: 23% mana | 3.2/5: 64% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos
4:37.350 default S incinerate Fluffy_Pillow 265631.2/1100000: 24% mana | 1.2/5: 24% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, extracted_sanity
4:38.357 default S incinerate Fluffy_Pillow 224850.8/1100000: 20% mana | 1.5/5: 30% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, extracted_sanity

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 75895 75895 46630
Intellect 61279 59573 49413 (4609)
Spirit 1 1 0
Health 4553700 4553700 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 61279 59573 0
Crit 23.42% 23.42% 7369
Haste 28.37% 27.37% 10264
Damage / Heal Versatility 8.10% 8.10% 3849
ManaReg per Second 14121 14011 0
Mastery 49.40% 49.40% 6681
Armor 2233 2233 2233
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 938.00
Local Head Diabolic Helm
ilevel: 930, stats: { 281 Armor, +4305 Sta, +2870 Int, +1082 Crit, +766 Mastery }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Lessons of Space-Time
ilevel: 970, stats: { 300 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Chest Diabolic Robe
ilevel: 930, stats: { 346 Armor, +4305 Sta, +2870 Int, +1241 Haste, +607 Vers }
Local Waist Feretory of Souls
ilevel: 970, stats: { 225 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Legs Diabolic Leggings
ilevel: 930, stats: { 303 Armor, +4305 Sta, +2870 Int, +1162 Mastery, +686 Haste }
Local Feet Slippers of Enduring Vigilance
ilevel: 930, stats: { 238 Armor, +3229 Sta, +2153 Int, +931 Haste, +455 Mastery }
Local Wrists Oathbreaker's Cuffs
ilevel: 930, stats: { 151 Armor, +2422 Sta, +1615 Int, +676 Crit, +364 Vers }
Local Hands Gloves of Furtive Oppression
ilevel: 930, stats: { 216 Armor, +3229 Sta, +2153 Int, +812 Crit, +574 Mastery }
Local Finger1 Yathae's Thumb Ring
ilevel: 930, stats: { +2422 Sta, +2414 Crit, +1106 Vers }, enchant: { +200 Haste }
Local Finger2 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Diabolic Shroud
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +676 Crit, +364 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 957, weapon: { 9093 - 13641, 3.6 }, stats: { +3691 Int, +5537 Sta, +1024 Haste, +1024 Mastery, +20134 Int }, relics: { +55 ilevels, +55 ilevels, +55 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="T19 4pc"
spec=destruction
level=110
race=troll
role=spell
position=back
talents=1203012
artifact=38:0:0:0:0:803:1:804:4:805:4:806:4:807:4:808:4:809:4:810:4:811:4:812:4:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1612:1:1713:1

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
actions+=/havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/cataclysm,if=spell_targets.cataclysm>=3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
actions+=/immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/use_items
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest,if=!buff.soul_harvest.remains
actions+=/chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
actions+=/rain_of_fire,if=active_enemies>=3
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=active_enemies<3&target.time_to_die<=10
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=diabolic_helm,id=147183,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant_id=5437
shoulders=lessons_of_spacetime,id=144369,ilevel=970
back=diabolic_shroud,id=147181,ilevel=930,enchant_id=5436
chest=diabolic_robe,id=147185,ilevel=930
wrists=oathbreakers_cuffs,id=147001,ilevel=930
hands=gloves_of_furtive_oppression,id=146988,ilevel=930
waist=feretory_of_souls,id=132456,ilevel=970
legs=diabolic_leggings,id=147184,ilevel=930
feet=slippers_of_enduring_vigilance,id=146987,ilevel=930
finger1=yathaes_thumb_ring,id=147021,ilevel=930,enchant_id=5428
finger2=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant_id=5428
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=scepter_of_sargeras,id=128941,ilevel=957,gem_id=147087/147090/147087

# Gear Summary
# gear_ilvl=938.47
# gear_stamina=46630
# gear_intellect=49413
# gear_crit_rating=7369
# gear_haste_rating=10264
# gear_mastery_rating=6681
# gear_versatility_rating=3849
# gear_armor=2233
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
default_pet=imp

T19 4pc - T20 2pc : 1379303 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1379303.0 1379303.0 2077.6 / 0.151% 201305.9 / 14.6% 44.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
23771.4 23771.4 Mana 0.00% 49.8 100.0% 100%
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Channel Demonfire (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T19 4pc - T20 2pc 1379303
Channel Demonfire 0 (163806) 0.0% (11.9%) 16.1 19.06sec 3057070 1262149

Stats details: channel_demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.09 0.00 240.54 0.00 2.4221 0.1453 0.00 0.00 0.00 1262148.94 1262148.94
 
 

Action details: channel_demonfire

Static Values
  • id:196447
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:52800.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
Spelldata
  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Channel Demonfire (_tick) 163806 11.9% 0.0 0.00sec 0 0 Direct 236.5 166775 333636 208029 24.7%  

Stats details: channel_demonfire_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 236.47 0.00 0.00 0.0000 0.0000 49192255.07 49192255.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.00 75.27% 166774.76 120066 242675 166927.19 157960 178757 29685998 29685998 0.00
crit 58.47 24.73% 333635.51 240133 485334 333982.38 310611 365872 19506257 19506257 0.00
 
 

Action details: channel_demonfire_tick

Static Values
  • id:196448
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Chaos Bolt 384526 27.9% 44.7 6.63sec 2586741 1742022 Direct 45.5 0 2541047 2541047 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.67 45.47 0.00 0.00 1.4849 0.0000 115551794.30 115551794.30 0.00 1742021.86 1742021.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 45.47 100.00% 2541046.86 1825728 3762998 2542161.05 2421806 2696938 115551794 115551794 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=1}} Chaos damage. Damage is further increased by your critical strike chance.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 132666 9.6% 42.9 7.05sec 928420 850742 Direct 42.9 495502 1193314 928421 62.0%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.91 42.91 0.00 0.00 1.0913 0.0000 39840242.77 39840242.77 0.00 850741.89 850741.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.29 37.96% 495502.43 359080 725702 495870.82 442888 547756 8072136 8072136 0.00
crit 26.62 62.04% 1193313.52 718454 1827236 1194195.88 1093682 1314765 31768107 31768107 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 6667 0.5% 14.0 2.12sec 140810 0 Direct 14.0 112903 225901 140821 24.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.98 13.98 0.00 0.00 0.0000 0.0000 1968692.20 1968692.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.53 75.30% 112902.83 98855 130488 112931.05 98855 125622 1188707 1188707 0.00
crit 3.45 24.70% 225900.81 197709 260976 221497.67 0 260976 779986 779986 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 110486 8.0% 17.2 17.91sec 1931920 1727984 Direct 17.2 270686 539849 424877 57.3%  
Periodic 136.3 120819 241232 190223 57.6% 98.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.20 17.20 136.28 136.28 1.1181 2.1815 33232579.87 33232579.87 0.00 104989.31 1727983.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.35 42.73% 270686.50 198314 400427 270843.37 224472 346857 1989469 1989469 0.00
crit 9.85 57.27% 539849.11 396666 801163 540239.67 465216 622640 5318801 5318801 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.7 42.36% 120819.25 252 179409 120908.45 114020 130108 6974554 6974554 0.00
crit 78.6 57.64% 241232.40 342 358864 241404.71 229711 257402 18949755 18949755 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 174236 12.7% 94.1 3.10sec 557169 495417 Direct 93.7 444798 886455 559540 26.0%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.10 93.70 0.00 0.00 1.1247 0.0000 52431440.25 52431440.25 0.00 495416.74 495416.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.36 74.02% 444798.27 330253 667497 445108.58 426224 471304 30852160 30852160 0.00
crit 24.34 25.98% 886454.94 660592 1334932 887058.67 812283 980271 21579280 21579280 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:55000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.84
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Insidious Corruption 13623 1.0% 5.1 60.51sec 806919 0 Periodic 42.8 77082 154112 95739 24.2% 19.8%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.08 0.00 42.84 42.84 0.0000 1.3956 4101164.28 4101164.28 0.00 68592.81 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.5 75.79% 77082.02 1309 103505 77071.16 73054 82477 2502765 2502765 0.00
crit 10.4 24.21% 154112.26 2618 207010 154152.08 110651 172508 1598399 1598399 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Spectral Owl 0 (73707) 0.0% (5.3%) 3.0 120.45sec 7307550 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.02 0.00 57.38 0.00 0.0000 1.0000 0.00 0.00 0.00 384025.68 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 22851 1.6% 33.2 7.97sec 205705 0 Direct 33.0 166655 333262 207067 24.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.20 32.99 0.00 0.00 0.0000 0.0000 6830355.13 6830355.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.98 75.74% 166654.74 138719 183108 166662.53 156659 177386 4163504 4163504 0.00
crit 8.00 24.26% 333261.71 277437 366217 332912.94 0 366217 2666851 2666851 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
    Spectral Bolt 50856 3.7% 85.7 3.04sec 177387 0 Direct 85.4 143233 286742 178116 24.3%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.71 85.36 0.00 0.00 0.0000 0.0000 15203502.21 15203502.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.61 75.70% 143232.60 118901 156949 143254.50 137791 149815 9254931 9254931 0.00
crit 20.75 24.30% 286741.84 237802 313898 286824.47 265837 309142 5948571 5948571 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90466.53
  • base_dd_max:99989.32
 
pet - infernal 107931 / 1161
Immolation 45815 0.0% 1.0 0.00sec 145623 0 Periodic 2.0 58311 116515 72804 24.9% 0.9%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 2.00 2.00 0.0000 1.3643 145622.62 145622.62 0.00 53380.73 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.5 75.09% 58311.00 57050 60799 55154.72 0 60799 87574 87574 0.00
crit 0.5 24.91% 116515.04 114100 121599 51759.59 0 121599 58049 58049 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 27121 0.0% 2.0 1.19sec 43168 31475 Direct 2.0 34922 69789 43157 23.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.3717 0.0000 86336.03 126922.14 31.98 31475.04 31475.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.53 76.35% 34921.50 34116 36358 33086.27 0 36358 53328 78398 30.30
crit 0.47 23.65% 69788.78 68232 72716 29350.95 0 72716 33008 48525 13.45
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Meteor Strike 34995 0.0% 1.0 0.00sec 111339 0 Direct 1.0 89703 179288 111311 24.1%  

Stats details: meteor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 111339.16 111339.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.76 75.85% 89702.97 87769 93537 68042.94 0 93537 68043 68043 0.00
crit 0.24 24.15% 179287.98 175538 187075 43296.22 0 187075 43296 43296 0.00
 
 

Action details: meteor_strike

Static Values
  • id:171018
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time>1
Spelldata
  • id:171018
  • name:Meteor Strike
  • school:fire
  • tooltip:Stunned.
  • description:The abyssal releases a powerful burst of flames, dealing {$s1=0} Fire damage to nearby targets, and stunning them for {$d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - doomguard 155633 / 153931
Doom Bolt 155633 11.2% 134.3 2.22sec 345023 156100 Direct 133.5 276097 551195 346999 25.8%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.26 133.49 0.00 0.00 2.2103 0.0000 46322061.27 46322061.27 0.00 156099.51 156099.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.08 74.22% 276096.98 240339 406790 276233.01 267432 287300 27356015 27356015 0.00
crit 34.41 25.78% 551194.60 480678 813580 551414.68 518108 603932 18966046 18966046 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 330116 / 27936
Immolation 206527 1.2% 3.0 0.00sec 1721125 0 Periodic 66.0 62952 125907 78230 24.3% 24.5%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 66.00 66.00 0.0000 1.1193 5163373.78 5163373.78 0.00 69894.33 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.0 75.73% 62951.80 51863 72959 62956.16 58582 68906 3146542 3146542 0.00
crit 16.0 24.27% 125906.92 103727 145918 125903.58 111432 141865 2016831 2016831 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 123589 0.7% 66.0 1.12sec 46816 41826 Direct 66.0 37696 75327 46814 24.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.00 66.00 0.00 0.00 1.1193 0.0000 3089860.15 4542387.11 31.98 41826.08 41826.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.01 75.77% 37696.46 31015 43630 37698.70 35202 40713 1885099 2771274 31.98
crit 15.99 24.23% 75327.41 62029 87260 75313.57 67198 85050 1204762 1771114 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 173547 / 25862
Shadow Bolt 173547 1.9% 3.6 68.17sec 2164944 0 Periodic 35.9 172278 344510 215563 25.1% 16.2%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 36.10 35.91 0.0000 1.3521 7741394.47 7741394.47 0.00 158589.64 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.9 74.86% 172277.69 805 224492 171485.98 0 218709 4631288 4631288 0.00
crit 9.0 25.14% 344509.64 2555 448983 341802.55 0 448983 3110106 3110106 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 236840 / 69743
Searing Bolt 236840 5.0% 69.8 2.64sec 296397 820017 Direct 69.4 90825 0 90825 0.0%  
Periodic 109.2 105246 209906 131821 25.4% 35.7%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.82 69.41 109.17 109.17 0.3615 0.9848 20693957.52 20693957.52 0.00 155879.64 820017.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.41 100.00% 90824.57 76514 112247 90917.58 82252 112247 6303427 6303427 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.5 74.61% 105246.33 964 157176 105110.99 0 127351 8572495 8572495 0.00
crit 27.7 25.39% 209905.92 4071 314352 209410.45 0 267197 5818036 5818036 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=20 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.070000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 368242 / 20872
Chaos Bolt 368242 1.5% 3.5 69.24sec 1802859 810203 Direct 3.5 0 1812738 1812738 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.49 3.47 0.00 0.00 2.2253 0.0000 6286362.58 6286362.58 0.00 810202.68 810202.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.47 100.00% 1812738.28 1662034 2261471 1811298.48 0 2261471 6286363 6286363 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:8.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 368909 / 23170
Chaos Barrage 368909 1.7% 3.6 67.83sec 1950862 0 Periodic 111.4 49893 99427 62415 25.3% 6.4%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 111.85 111.35 0.0000 0.1736 6950195.34 6950195.34 0.00 357851.68 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.2 74.72% 49892.81 265 61736 49661.16 0 61736 4151305 4151305 0.00
crit 28.1 25.28% 99426.57 794 123473 99047.22 0 123473 2798890 2798890 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
T19 4pc - T20 2pc
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 4pc - T20 2pc
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.51sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.9 23.52sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.86 0.00 0.00 0.00 1.1179 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target. |cFFFFFFFFGenerates {$s2=3} Soul Shard Fragments.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 4pc - T20 2pc
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 4pc - T20 2pc
  • harmful:false
  • if_expr:
 
Life Tap 5.6 38.21sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.64 0.00 0.00 0.00 1.1592 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 3.0 121.19sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.soul_harvest.remains
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7767 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Backdraft 37.0 5.9 8.2sec 7.0sec 58.28% 49.48% 0.0(0.0) 1.6

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:17.81%
  • backdraft_2:34.88%
  • backdraft_3:2.79%
  • backdraft_4:2.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Berserking 2.1 0.0 180.5sec 180.5sec 6.89% 10.86% 0.0(0.0) 2.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 13.54% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.4 3.1 35.4sec 25.0sec 32.40% 32.40% 3.1(3.1) 8.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagration of Chaos 21.5 0.0 13.9sec 13.9sec 53.07% 49.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:53.07%

Trigger Attempt Success

  • trigger_pct:50.26%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a {$h=50}% chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Embrace Chaos 30.1 15.6 10.2sec 6.6sec 51.55% 53.84% 15.6(15.6) 29.4

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_embrace_chaos
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • embrace_chaos_1:51.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212019
  • name:Embrace Chaos
  • tooltip:Chaos Bolt has {$s1=40}% reduced cast time.
  • description:{$@spelldesc212018=Casting Chaos Bolt reduces the cast time of your next Chaos Bolt by {$212019s1=40}% for {$212019d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.3sec 60.3sec 19.16% 19.16% 0.0(0.0) 4.7

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lessons of Space-Time 10.5 3.4 29.7sec 23.5sec 38.68% 38.68% 3.4(3.4) 10.2

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_lessons_of_spacetime
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • lessons_of_spacetime_1:38.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:236176
  • name:Lessons of Space-Time
  • tooltip:You and your minions deal {$s1=10}% increased damage.
  • description:{$@spelldesc236174=While you have a Dimensional Rift open, all of your damage is increased by {$236176s1=10}%.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 99.63% 99.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.1 4.2 22.9sec 17.1sec 30.15% 30.15% 4.2(4.2) 12.8

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.15% 10.15% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.63% 19.63% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 3.0 0.0 121.2sec 121.2sec 13.42% 100.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • soul_harvest_1:13.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.5 68.3sec
flame_rift 3.4 69.3sec
chaos_tear 3.4 69.5sec
chaos_portal 3.5 67.5sec
dimension_ripper 4.7 49.5sec
t19_2pc_chaos_bolt 20.4 14.5sec

Resources

Resource Usage Type Count Total Average RPE APR
T19 4pc - T20 2pc
channel_demonfire Mana 27.8 1468906.2 52800.0 91285.7 33.5
chaos_bolt Soul Shard 79.0 157.9 2.0 3.5 731737.6
immolate Mana 29.7 1962838.2 66000.0 114106.3 16.9
incinerate Mana 162.7 8948188.1 55000.0 95089.0 5.9
summon_doomguard Soul Shard 1.7 1.7 1.0 1.7 0.0
pet - doomguard
doom_bolt Energy 134.3 4699.0 35.0 35.0 9857.9
pet - flame_rift
searing_bolt Energy 68.3 68.3 1.0 1.0 303115.8
Resource Gains Type Count Total Average Overflow
life_tap Mana 9.75 3216244.81 (29.59%) 330000.00 0.00 0.00%
immolate Soul Shard 235.61 22.23 (14.15%) 0.09 1.33 5.64%
dimensional_rift Soul Shard 23.96 6.83 (4.35%) 0.29 0.36 4.94%
conflagrate Soul Shard 74.19 36.29 (23.09%) 0.49 0.81 2.18%
incinerate Soul Shard 162.69 32.18 (20.48%) 0.20 0.36 1.11%
mp5_regen Mana 1338.72 7654559.44 (70.41%) 5717.80 130039.66 1.67%
immolate_crits Soul Shard 68.24 6.47 (4.11%) 0.09 0.36 5.25%
soulsnatcher Soul Shard 11.86 11.86 (7.55%) 1.00 0.00 0.00%
feretory_of_souls Soul Shard 22.39 21.07 (13.41%) 0.94 1.32 5.89%
incinerate_crits Soul Shard 42.25 4.17 (2.65%) 0.10 0.06 1.42%
destruction_t20_2pc Soul Shard 162.69 16.03 (10.20%) 0.10 0.24 1.46%
pet - doomguard
energy_regen Energy 232.12 8063.57 (100.00%) 34.74 269.23 3.23%
Resource RPS-Gain RPS-Loss
Health 0.00 8521.75
Mana 20873.44 23771.39
Soul Shard 0.30 0.31
Combat End Resource Mean Min Max
Mana 229676.65 17169.35 484907.14
Soul Shard 1.55 0.00 4.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.9%

Statistics & Data Analysis

Fight Length
Sample Data T19 4pc - T20 2pc Fight Length
Count 2497
Mean 301.23
Minimum 211.06
Maximum 386.09
Spread ( max - min ) 175.04
Range [ ( max - min ) / 2 * 100% ] 29.05%
Standard Deviation 41.3874
5th Percentile 240.03
95th Percentile 366.98
( 95th Percentile - 5th Percentile ) 126.94
Mean Distribution
Standard Deviation 0.8282
95.00% Confidence Intervall ( 299.61 - 302.85 )
Normalized 95.00% Confidence Intervall ( 99.46% - 100.54% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 726
0.1% Error 72518
0.1 Scale Factor Error with Delta=300 15
0.05 Scale Factor Error with Delta=300 59
0.01 Scale Factor Error with Delta=300 1463
DPS
Sample Data T19 4pc - T20 2pc Damage Per Second
Count 2497
Mean 1379303.01
Minimum 1179548.06
Maximum 1582781.72
Spread ( max - min ) 403233.66
Range [ ( max - min ) / 2 * 100% ] 14.62%
Standard Deviation 52969.4864
5th Percentile 1298580.80
95th Percentile 1468413.44
( 95th Percentile - 5th Percentile ) 169832.64
Mean Distribution
Standard Deviation 1060.0259
95.00% Confidence Intervall ( 1377225.40 - 1381380.63 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5666
0.1 Scale Factor Error with Delta=300 23951637
0.05 Scale Factor Error with Delta=300 95806547
0.01 Scale Factor Error with Delta=300 2395163657
Priority Target DPS
Sample Data T19 4pc - T20 2pc Priority Target Damage Per Second
Count 2497
Mean 1379303.01
Minimum 1179548.06
Maximum 1582781.72
Spread ( max - min ) 403233.66
Range [ ( max - min ) / 2 * 100% ] 14.62%
Standard Deviation 52969.4864
5th Percentile 1298580.80
95th Percentile 1468413.44
( 95th Percentile - 5th Percentile ) 169832.64
Mean Distribution
Standard Deviation 1060.0259
95.00% Confidence Intervall ( 1377225.40 - 1381380.63 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5666
0.1 Scale Factor Error with Delta=300 23951637
0.05 Scale Factor Error with Delta=300 95806547
0.01 Scale Factor Error with Delta=300 2395163657
DPS(e)
Sample Data T19 4pc - T20 2pc Damage Per Second (Effective)
Count 2497
Mean 1379303.01
Minimum 1179548.06
Maximum 1582781.72
Spread ( max - min ) 403233.66
Range [ ( max - min ) / 2 * 100% ] 14.62%
Damage
Sample Data T19 4pc - T20 2pc Damage
Count 2497
Mean 318352026.07
Minimum 239184654.75
Maximum 398388370.07
Spread ( max - min ) 159203715.32
Range [ ( max - min ) / 2 * 100% ] 25.00%
DTPS
Sample Data T19 4pc - T20 2pc Damage Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T19 4pc - T20 2pc Healing Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T19 4pc - T20 2pc Healing Per Second (Effective)
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T19 4pc - T20 2pc Heal
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T19 4pc - T20 2pc Healing Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T19 4pc - T20 2pc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data T19 4pc - T20 2pcTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T19 4pc - T20 2pc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
0.00 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
C 1.11 dimensional_rift,if=charges=3
0.00 cataclysm,if=spell_targets.cataclysm>=3
D 6.04 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
0.00 immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
E 2.08 berserking
0.00 blood_fury
F 8.10 use_items
G 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
H 21.90 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
I 0.42 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
J 1.15 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
0.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
K 1.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
L 2.97 soul_harvest,if=!buff.soul_harvest.remains
0.00 chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
M 16.09 channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
0.00 rain_of_fire,if=active_enemies>=3
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
N 11.61 dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
O 1.98 chaos_bolt,if=active_enemies<3&target.time_to_die<=10
P 42.84 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
0.00 shadowburn
Q 20.59 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
R 11.22 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
S 94.42 incinerate
T 5.64 life_tap

Sample Sequence

0136ABCDEFHHKLMNPSQHPSSHPSPRSSHMNFSSHPSNSSNPQRMHPPSSSHPNSSSHPMDSQSPSSSNQPRSSMPQSSHFPSSSPQDNMSHPPSSNPQRSSSSMQSNPHPFSPJLGRTQSSSMHPSSPRFHSSSPSQMSSTHSRSSSPPQSSMHPPRSNEPQSSSPSHMSTSHRSSPFPQPSSSMHRSPSSHPSNSTQMRSSHSSNPFSHPLPSSMHDPSSHNSSTFSSHNMDNHPSSSSPPQROSMHOSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T19 4pc - T20 2pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food T19 4pc - T20 2pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_infernal Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation T19 4pc - T20 2pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:00.000 default C dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:01.148 default D immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.3/5: 46% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:02.030 default E berserking Fluffy_Pillow 1034037.5/1100000: 94% mana | 2.3/5: 46% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:02.030 default F use_items Fluffy_Pillow 1034037.5/1100000: 94% mana | 2.3/5: 46% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:02.030 default H conflagrate Fluffy_Pillow 1034037.5/1100000: 94% mana | 2.3/5: 46% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:02.802 default H conflagrate Fluffy_Pillow 1050673.4/1100000: 96% mana | 2.8/5: 56% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:03.574 default K summon_doomguard Fluffy_Pillow 1067309.3/1100000: 97% mana | 3.3/5: 66% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:04.343 default L soul_harvest Fluffy_Pillow 1083880.5/1100000: 99% mana | 2.4/5: 48% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:04.343 default M channel_demonfire Fluffy_Pillow 1083880.5/1100000: 99% mana | 2.4/5: 48% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:06.016 default N dimensional_rift Fluffy_Pillow 1067125.1/1100000: 97% mana | 2.5/5: 50% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:06.803 default P chaos_bolt Fluffy_Pillow 1083739.1/1100000: 99% mana | 2.8/5: 56% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:07.899 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.9/5: 18% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(3), lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:08.653 default Q conflagrate Fluffy_Pillow 1046773.3/1100000: 95% mana | 1.3/5: 26% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.438 default H conflagrate Fluffy_Pillow 1063345.1/1100000: 97% mana | 1.8/5: 36% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.222 default P chaos_bolt Fluffy_Pillow 1080003.2/1100000: 98% mana | 2.4/5: 48% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:10.976 default S incinerate Fluffy_Pillow 1096251.2/1100000: 100% mana | 0.4/5: 8% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(3), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:11.730 default S incinerate Fluffy_Pillow 1047090.3/1100000: 95% mana | 0.9/5: 18% soul_shard bloodlust, berserking, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:12.484 default H conflagrate Fluffy_Pillow 1007062.2/1100000: 92% mana | 2.2/5: 44% soul_shard bloodlust, soul_harvest, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:13.368 default P chaos_bolt Fluffy_Pillow 1023626.9/1100000: 93% mana | 3.8/5: 76% soul_shard bloodlust, soul_harvest, backdraft(3), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:14.120 default S incinerate Fluffy_Pillow 1037718.1/1100000: 94% mana | 1.8/5: 36% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:14.881 default P chaos_bolt Fluffy_Pillow 996978.0/1100000: 91% mana | 2.2/5: 44% soul_shard bloodlust, soul_harvest, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:15.635 default R immolate Fluffy_Pillow 1011106.7/1100000: 92% mana | 0.2/5: 4% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:16.520 default S incinerate Fluffy_Pillow 961483.1/1100000: 87% mana | 0.2/5: 4% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.626 default S incinerate Fluffy_Pillow 926785.9/1100000: 84% mana | 0.8/5: 16% soul_shard bloodlust, soul_harvest, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.732 default H conflagrate Fluffy_Pillow 892088.8/1100000: 81% mana | 1.2/5: 24% soul_shard bloodlust, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:19.634 default M channel_demonfire Fluffy_Pillow 908646.8/1100000: 83% mana | 1.7/5: 34% soul_shard bloodlust, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:21.759 default N dimensional_rift Fluffy_Pillow 894855.4/1100000: 81% mana | 1.8/5: 36% soul_shard bloodlust, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:22.662 default F use_items Fluffy_Pillow 911431.8/1100000: 83% mana | 2.3/5: 46% soul_shard bloodlust, lessons_of_spacetime, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:22.662 default S incinerate Fluffy_Pillow 911431.8/1100000: 83% mana | 2.3/5: 46% soul_shard bloodlust, lessons_of_spacetime, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:23.439 default S incinerate Fluffy_Pillow 870695.2/1100000: 79% mana | 2.7/5: 54% soul_shard bloodlust, lessons_of_spacetime, backdraft, lord_of_flames, potion_of_prolonged_power
0:24.215 default H conflagrate Fluffy_Pillow 829940.2/1100000: 75% mana | 3.2/5: 64% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, potion_of_prolonged_power
0:25.117 default P chaos_bolt Fluffy_Pillow 846498.2/1100000: 77% mana | 4.7/5: 94% soul_shard bloodlust, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:26.379 default S incinerate Fluffy_Pillow 869664.8/1100000: 79% mana | 2.8/5: 56% soul_shard bloodlust, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:27.155 default N dimensional_rift Fluffy_Pillow 828909.8/1100000: 75% mana | 3.2/5: 64% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:28.057 default S incinerate Fluffy_Pillow 845467.8/1100000: 77% mana | 3.6/5: 72% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:29.161 default S incinerate Fluffy_Pillow 810734.0/1100000: 74% mana | 4.0/5: 80% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:30.266 default N dimensional_rift Fluffy_Pillow 776018.5/1100000: 71% mana | 4.4/5: 88% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:31.167 default P chaos_bolt Fluffy_Pillow 792558.1/1100000: 72% mana | 4.8/5: 96% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:32.969 default Q conflagrate Fluffy_Pillow 825637.4/1100000: 75% mana | 2.9/5: 58% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_prolonged_power
0:33.873 default R immolate Fluffy_Pillow 842232.2/1100000: 77% mana | 3.4/5: 68% soul_shard bloodlust, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:34.777 default M channel_demonfire Fluffy_Pillow 792826.9/1100000: 72% mana | 3.6/5: 72% soul_shard bloodlust, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:36.864 default H conflagrate Fluffy_Pillow 778338.0/1100000: 71% mana | 3.7/5: 74% soul_shard bloodlust, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, extracted_sanity, potion_of_prolonged_power
0:37.767 default P chaos_bolt Fluffy_Pillow 794914.4/1100000: 72% mana | 5.0/5: 100% soul_shard bloodlust, lessons_of_spacetime, backdraft(4), lord_of_flames, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:39.027 default P chaos_bolt Fluffy_Pillow 818044.2/1100000: 74% mana | 3.0/5: 60% soul_shard bloodlust, lessons_of_spacetime, backdraft(3), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:39.784 default S incinerate Fluffy_Pillow 831940.4/1100000: 76% mana | 1.0/5: 20% soul_shard bloodlust, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:40.559 default S incinerate Fluffy_Pillow 791167.1/1100000: 72% mana | 1.5/5: 30% soul_shard bloodlust, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:41.336 default S incinerate Fluffy_Pillow 747139.0/1100000: 68% mana | 1.8/5: 36% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:42.775 default H conflagrate Fluffy_Pillow 712458.8/1100000: 65% mana | 3.2/5: 64% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:43.947 default P chaos_bolt Fluffy_Pillow 729008.3/1100000: 66% mana | 3.7/5: 74% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:45.586 default N dimensional_rift Fluffy_Pillow 752152.2/1100000: 68% mana | 1.8/5: 36% soul_shard backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:46.759 default S incinerate Fluffy_Pillow 768715.9/1100000: 70% mana | 2.2/5: 44% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.768 default S incinerate Fluffy_Pillow 727963.8/1100000: 66% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:49.206 default S incinerate Fluffy_Pillow 693269.4/1100000: 63% mana | 4.0/5: 80% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, potion_of_prolonged_power
0:50.645 default H conflagrate Fluffy_Pillow 658589.2/1100000: 60% mana | 4.3/5: 86% soul_shard lord_of_flames, potion_of_prolonged_power
0:51.817 default P chaos_bolt Fluffy_Pillow 675138.8/1100000: 61% mana | 4.9/5: 98% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:53.454 default M channel_demonfire Fluffy_Pillow 698261.2/1100000: 63% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:55.938 default D immolate Fluffy_Pillow 681265.9/1100000: 62% mana | 3.2/5: 64% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:57.087 default S incinerate Fluffy_Pillow 631827.7/1100000: 57% mana | 3.3/5: 66% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw, potion_of_prolonged_power
0:58.073 default Q conflagrate Fluffy_Pillow 591040.0/1100000: 54% mana | 3.6/5: 72% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
0:59.223 default S incinerate Fluffy_Pillow 607616.2/1100000: 55% mana | 4.1/5: 82% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:00.212 default P chaos_bolt Fluffy_Pillow 566871.8/1100000: 52% mana | 4.6/5: 92% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:01.820 default S incinerate Fluffy_Pillow 590049.7/1100000: 54% mana | 2.7/5: 54% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
1:03.226 default S incinerate Fluffy_Pillow 555315.9/1100000: 50% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
1:04.636 default S incinerate Fluffy_Pillow 520473.5/1100000: 47% mana | 3.4/5: 68% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:06.072 default N dimensional_rift Fluffy_Pillow 485750.9/1100000: 44% mana | 3.8/5: 76% soul_shard lord_of_flames, conflagration_of_chaos
1:07.244 default Q conflagrate Fluffy_Pillow 502300.4/1100000: 46% mana | 4.2/5: 84% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
1:08.417 default P chaos_bolt Fluffy_Pillow 518864.1/1100000: 47% mana | 4.7/5: 94% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos
1:10.056 default R immolate Fluffy_Pillow 542008.0/1100000: 49% mana | 3.8/5: 76% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:11.231 default S incinerate Fluffy_Pillow 492600.0/1100000: 45% mana | 3.9/5: 78% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:12.238 default S incinerate Fluffy_Pillow 451819.6/1100000: 41% mana | 4.2/5: 84% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:13.677 default M channel_demonfire Fluffy_Pillow 417139.4/1100000: 38% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:16.269 default P chaos_bolt Fluffy_Pillow 400940.4/1100000: 36% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos
1:18.611 default Q conflagrate Fluffy_Pillow 434011.3/1100000: 39% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:19.783 default S incinerate Fluffy_Pillow 450560.8/1100000: 41% mana | 3.5/5: 70% soul_shard backdraft(2), lord_of_flames, embrace_chaos
1:20.790 default S incinerate Fluffy_Pillow 409780.4/1100000: 37% mana | 3.9/5: 78% soul_shard backdraft, lord_of_flames, embrace_chaos
1:21.797 default H conflagrate Fluffy_Pillow 369000.0/1100000: 34% mana | 4.2/5: 84% soul_shard lord_of_flames, embrace_chaos
1:22.970 default F use_items Fluffy_Pillow 385563.7/1100000: 35% mana | 4.9/5: 98% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
1:22.970 default P chaos_bolt Fluffy_Pillow 385563.7/1100000: 35% mana | 4.9/5: 98% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
1:24.608 default S incinerate Fluffy_Pillow 408693.5/1100000: 37% mana | 2.9/5: 58% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos
1:25.614 default S incinerate Fluffy_Pillow 367899.0/1100000: 33% mana | 3.3/5: 66% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:27.051 default S incinerate Fluffy_Pillow 333190.6/1100000: 30% mana | 3.6/5: 72% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos
1:28.489 default P chaos_bolt Fluffy_Pillow 298497.7/1100000: 27% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
1:29.865 default Q conflagrate Fluffy_Pillow 318331.5/1100000: 29% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
1:31.014 default D immolate Fluffy_Pillow 334893.3/1100000: 30% mana | 3.5/5: 70% soul_shard backdraft(2), lord_of_flames, embrace_chaos, mark_of_the_claw
1:32.161 default N dimensional_rift Fluffy_Pillow 285426.3/1100000: 26% mana | 3.7/5: 74% soul_shard backdraft(2), lord_of_flames, embrace_chaos, mark_of_the_claw
1:33.308 default M channel_demonfire Fluffy_Pillow 301959.3/1100000: 27% mana | 4.1/5: 82% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, mark_of_the_claw
1:35.768 default S incinerate Fluffy_Pillow 284618.0/1100000: 26% mana | 4.2/5: 84% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, extracted_sanity, mark_of_the_claw
1:36.753 default H conflagrate Fluffy_Pillow 243815.9/1100000: 22% mana | 4.6/5: 92% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, extracted_sanity, mark_of_the_claw
1:37.903 default P chaos_bolt Fluffy_Pillow 260392.1/1100000: 24% mana | 5.0/5: 100% soul_shard backdraft(3), lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
1:39.509 default P chaos_bolt Fluffy_Pillow 283541.2/1100000: 26% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:40.471 default S incinerate Fluffy_Pillow 297407.6/1100000: 27% mana | 1.1/5: 22% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:41.459 default S incinerate Fluffy_Pillow 256648.7/1100000: 23% mana | 1.4/5: 28% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:42.867 default N dimensional_rift Fluffy_Pillow 221909.4/1100000: 20% mana | 1.9/5: 38% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
1:44.039 default P chaos_bolt Fluffy_Pillow 238459.0/1100000: 22% mana | 2.2/5: 44% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
1:45.445 default Q conflagrate Fluffy_Pillow 258312.8/1100000: 23% mana | 0.3/5: 6% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
1:46.617 default R immolate Fluffy_Pillow 274862.3/1100000: 25% mana | 0.8/5: 16% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
1:47.790 default S incinerate Fluffy_Pillow 225426.0/1100000: 20% mana | 0.9/5: 18% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
1:48.797 default S incinerate Fluffy_Pillow 184645.6/1100000: 17% mana | 2.2/5: 44% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
1:49.806 default S incinerate Fluffy_Pillow 143893.5/1100000: 13% mana | 2.6/5: 52% soul_shard lord_of_flames, conflagration_of_chaos
1:51.242 default S incinerate Fluffy_Pillow 109170.9/1100000: 10% mana | 2.9/5: 58% soul_shard lord_of_flames, conflagration_of_chaos
1:52.681 default M channel_demonfire Fluffy_Pillow 74490.7/1100000: 7% mana | 3.4/5: 68% soul_shard lord_of_flames, conflagration_of_chaos
1:55.220 default Q conflagrate Fluffy_Pillow 57543.3/1100000: 5% mana | 3.6/5: 72% soul_shard lord_of_flames, conflagration_of_chaos
1:56.393 default S incinerate Fluffy_Pillow 74161.6/1100000: 7% mana | 4.2/5: 84% soul_shard backdraft(2), lord_of_flames, mark_of_the_claw
1:57.382 default N dimensional_rift Fluffy_Pillow 33417.1/1100000: 3% mana | 4.6/5: 92% soul_shard backdraft, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
1:58.532 default P chaos_bolt Fluffy_Pillow 49993.3/1100000: 5% mana | 4.9/5: 98% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
2:00.138 default H conflagrate Fluffy_Pillow 73142.4/1100000: 7% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
2:01.287 default P chaos_bolt Fluffy_Pillow 89704.2/1100000: 8% mana | 3.7/5: 74% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
2:02.253 default F use_items Fluffy_Pillow 103614.7/1100000: 9% mana | 1.7/5: 34% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
2:02.253 default S incinerate Fluffy_Pillow 103614.7/1100000: 9% mana | 1.7/5: 34% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
2:03.261 default P chaos_bolt Fluffy_Pillow 62848.5/1100000: 6% mana | 2.1/5: 42% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
2:04.668 default J dimensional_rift Fluffy_Pillow 82716.4/1100000: 8% mana | 0.1/5: 2% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
2:05.840 default L soul_harvest Fluffy_Pillow 99378.3/1100000: 9% mana | 0.6/5: 12% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
2:05.840 default G potion Fluffy_Pillow 99378.3/1100000: 9% mana | 0.6/5: 12% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
2:05.840 default R immolate Fluffy_Pillow 99378.3/1100000: 9% mana | 0.6/5: 12% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:06.988 default T life_tap Fluffy_Pillow 49925.7/1100000: 5% mana | 0.6/5: 12% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:08.137 default Q conflagrate Fluffy_Pillow 396487.5/1100000: 36% mana | 0.7/5: 14% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:09.286 default S incinerate Fluffy_Pillow 413049.3/1100000: 38% mana | 1.2/5: 24% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:10.273 default S incinerate Fluffy_Pillow 372276.0/1100000: 34% mana | 1.6/5: 32% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:11.258 default S incinerate Fluffy_Pillow 331473.9/1100000: 30% mana | 1.9/5: 38% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_deadly_grace
2:12.667 default M channel_demonfire Fluffy_Pillow 296428.5/1100000: 27% mana | 2.4/5: 48% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, potion_of_deadly_grace
2:15.024 default H conflagrate Fluffy_Pillow 276911.1/1100000: 25% mana | 2.5/5: 50% soul_shard soul_harvest, lord_of_flames, concordance_of_the_legionfall, potion_of_deadly_grace
2:16.294 default P chaos_bolt Fluffy_Pillow 294844.5/1100000: 27% mana | 3.0/5: 60% soul_shard soul_harvest, backdraft(2), lord_of_flames, concordance_of_the_legionfall, potion_of_deadly_grace
2:17.933 default S incinerate Fluffy_Pillow 317988.5/1100000: 29% mana | 1.2/5: 24% soul_shard soul_harvest, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:18.941 default S incinerate Fluffy_Pillow 277222.2/1100000: 25% mana | 1.5/5: 30% soul_shard soul_harvest, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:20.379 default P chaos_bolt Fluffy_Pillow 242527.9/1100000: 22% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:21.783 default R immolate Fluffy_Pillow 262353.4/1100000: 24% mana | 0.2/5: 4% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:22.955 default F use_items Fluffy_Pillow 212903.0/1100000: 19% mana | 0.2/5: 4% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:22.955 default H conflagrate Fluffy_Pillow 212903.0/1100000: 19% mana | 0.2/5: 4% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:24.127 default S incinerate Fluffy_Pillow 229452.5/1100000: 21% mana | 0.9/5: 18% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:25.135 default S incinerate Fluffy_Pillow 188686.3/1100000: 17% mana | 1.2/5: 24% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, potion_of_deadly_grace
2:26.143 default S incinerate Fluffy_Pillow 147920.0/1100000: 13% mana | 1.6/5: 32% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:27.581 default P chaos_bolt Fluffy_Pillow 113225.7/1100000: 10% mana | 2.1/5: 42% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:29.921 default S incinerate Fluffy_Pillow 146268.3/1100000: 13% mana | 0.3/5: 6% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:31.357 default Q conflagrate Fluffy_Pillow 111545.7/1100000: 10% mana | 0.8/5: 16% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:32.531 default M channel_demonfire Fluffy_Pillow 128123.5/1100000: 12% mana | 1.3/5: 26% soul_shard backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:35.071 default S incinerate Fluffy_Pillow 111190.3/1100000: 10% mana | 1.4/5: 28% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity, potion_of_deadly_grace
2:36.079 default S incinerate Fluffy_Pillow 70526.1/1100000: 6% mana | 1.8/5: 36% soul_shard backdraft, lord_of_flames, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:37.064 default T life_tap Fluffy_Pillow 29724.0/1100000: 3% mana | 2.2/5: 44% soul_shard lord_of_flames, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:38.212 default H conflagrate Fluffy_Pillow 376271.4/1100000: 34% mana | 2.3/5: 46% soul_shard lord_of_flames, extracted_sanity, mark_of_the_claw
2:39.581 default S incinerate Fluffy_Pillow 396004.3/1100000: 36% mana | 2.8/5: 56% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
2:40.568 default R immolate Fluffy_Pillow 355231.0/1100000: 32% mana | 3.3/5: 66% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
2:41.718 default S incinerate Fluffy_Pillow 305807.3/1100000: 28% mana | 3.3/5: 66% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
2:42.703 default S incinerate Fluffy_Pillow 264720.0/1100000: 24% mana | 3.8/5: 76% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
2:44.142 default S incinerate Fluffy_Pillow 230039.8/1100000: 21% mana | 4.2/5: 84% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
2:45.580 default P chaos_bolt Fluffy_Pillow 195345.5/1100000: 18% mana | 4.6/5: 92% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
2:47.921 default P chaos_bolt Fluffy_Pillow 228579.4/1100000: 21% mana | 4.7/5: 94% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
2:49.298 default Q conflagrate Fluffy_Pillow 248427.6/1100000: 23% mana | 2.7/5: 54% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
2:50.444 default S incinerate Fluffy_Pillow 264946.2/1100000: 24% mana | 3.3/5: 66% soul_shard backdraft(2), lord_of_flames, embrace_chaos, mark_of_the_claw
2:51.431 default S incinerate Fluffy_Pillow 224172.9/1100000: 20% mana | 3.6/5: 72% soul_shard backdraft, lord_of_flames, embrace_chaos, mark_of_the_claw
2:52.419 default M channel_demonfire Fluffy_Pillow 183414.0/1100000: 17% mana | 4.0/5: 80% soul_shard lord_of_flames, embrace_chaos, mark_of_the_claw
2:54.960 default H conflagrate Fluffy_Pillow 166758.3/1100000: 15% mana | 4.1/5: 82% soul_shard lord_of_flames, concordance_of_the_legionfall
2:56.133 default P chaos_bolt Fluffy_Pillow 183322.0/1100000: 17% mana | 4.6/5: 92% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
2:57.772 default P chaos_bolt Fluffy_Pillow 206466.0/1100000: 19% mana | 2.7/5: 54% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
2:58.757 default R immolate Fluffy_Pillow 220374.9/1100000: 20% mana | 1.7/5: 34% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
2:59.930 default S incinerate Fluffy_Pillow 170938.6/1100000: 16% mana | 1.9/5: 38% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:01.368 default N dimensional_rift Fluffy_Pillow 136244.3/1100000: 12% mana | 2.3/5: 46% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:02.539 default E berserking Fluffy_Pillow 152779.7/1100000: 14% mana | 2.6/5: 52% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:02.539 default P chaos_bolt Fluffy_Pillow 152779.7/1100000: 14% mana | 2.6/5: 52% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:03.762 default Q conflagrate Fluffy_Pillow 172702.9/1100000: 16% mana | 0.7/5: 14% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:04.763 default S incinerate Fluffy_Pillow 189295.7/1100000: 17% mana | 1.2/5: 24% soul_shard berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:05.622 default S incinerate Fluffy_Pillow 148534.7/1100000: 14% mana | 1.6/5: 32% soul_shard berserking, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:06.481 default S incinerate Fluffy_Pillow 107773.7/1100000: 10% mana | 1.9/5: 38% soul_shard berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:07.706 default P chaos_bolt Fluffy_Pillow 73079.6/1100000: 7% mana | 2.5/5: 50% soul_shard berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:08.904 default S incinerate Fluffy_Pillow 92937.9/1100000: 8% mana | 0.5/5: 10% soul_shard berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:10.130 default H conflagrate Fluffy_Pillow 58073.1/1100000: 5% mana | 0.9/5: 18% soul_shard berserking, lessons_of_spacetime, lord_of_flames, embrace_chaos
3:11.150 default M channel_demonfire Fluffy_Pillow 74636.8/1100000: 7% mana | 1.4/5: 28% soul_shard berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos
3:13.405 default S incinerate Fluffy_Pillow 56621.2/1100000: 5% mana | 1.5/5: 30% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
3:14.410 default T life_tap Fluffy_Pillow 15812.5/1100000: 1% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
3:15.584 default S incinerate Fluffy_Pillow 362390.3/1100000: 33% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
3:16.590 default H conflagrate Fluffy_Pillow 321595.8/1100000: 29% mana | 2.4/5: 48% soul_shard lessons_of_spacetime, lord_of_flames
3:17.884 default R immolate Fluffy_Pillow 339868.1/1100000: 31% mana | 2.9/5: 58% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:19.056 default S incinerate Fluffy_Pillow 290417.7/1100000: 26% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:20.063 default S incinerate Fluffy_Pillow 249637.3/1100000: 23% mana | 3.3/5: 66% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:21.070 default P chaos_bolt Fluffy_Pillow 208856.9/1100000: 19% mana | 4.8/5: 96% soul_shard lord_of_flames, conflagration_of_chaos
3:23.410 default F use_items Fluffy_Pillow 241899.5/1100000: 22% mana | 2.9/5: 58% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:23.410 default P chaos_bolt Fluffy_Pillow 241899.5/1100000: 22% mana | 2.9/5: 58% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall
3:24.816 default Q conflagrate Fluffy_Pillow 261754.8/1100000: 24% mana | 0.9/5: 18% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:25.967 default P chaos_bolt Fluffy_Pillow 278345.4/1100000: 25% mana | 2.5/5: 50% soul_shard backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:26.932 default S incinerate Fluffy_Pillow 292255.0/1100000: 27% mana | 0.5/5: 10% soul_shard backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:27.919 default S incinerate Fluffy_Pillow 251481.8/1100000: 23% mana | 0.9/5: 18% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:29.328 default S incinerate Fluffy_Pillow 216791.2/1100000: 20% mana | 1.2/5: 24% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:30.738 default M channel_demonfire Fluffy_Pillow 182115.1/1100000: 17% mana | 1.7/5: 34% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:33.327 default H conflagrate Fluffy_Pillow 165895.2/1100000: 15% mana | 1.9/5: 38% soul_shard lord_of_flames
3:34.501 default R immolate Fluffy_Pillow 182473.0/1100000: 17% mana | 2.4/5: 48% soul_shard backdraft(2), lord_of_flames
3:35.674 default S incinerate Fluffy_Pillow 133036.7/1100000: 12% mana | 2.5/5: 50% soul_shard backdraft(2), lord_of_flames, extracted_sanity
3:36.682 default P chaos_bolt Fluffy_Pillow 92270.4/1100000: 8% mana | 2.8/5: 56% soul_shard backdraft, lord_of_flames, concordance_of_the_legionfall, extracted_sanity
3:38.323 default S incinerate Fluffy_Pillow 115442.6/1100000: 10% mana | 0.9/5: 18% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
3:39.761 default S incinerate Fluffy_Pillow 80748.3/1100000: 7% mana | 1.3/5: 26% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
3:41.200 default H conflagrate Fluffy_Pillow 46068.1/1100000: 4% mana | 1.7/5: 34% soul_shard lord_of_flames, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
3:42.373 default P chaos_bolt Fluffy_Pillow 62631.7/1100000: 6% mana | 2.3/5: 46% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
3:44.012 default S incinerate Fluffy_Pillow 85775.7/1100000: 8% mana | 0.5/5: 10% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity
3:45.022 default N dimensional_rift Fluffy_Pillow 45039.7/1100000: 4% mana | 0.8/5: 16% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:46.170 default S incinerate Fluffy_Pillow 61587.1/1100000: 6% mana | 1.1/5: 22% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:47.580 default T life_tap Fluffy_Pillow 26911.0/1100000: 2% mana | 1.5/5: 30% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
3:48.729 default Q conflagrate Fluffy_Pillow 373472.8/1100000: 34% mana | 1.7/5: 34% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:49.878 default M channel_demonfire Fluffy_Pillow 390034.6/1100000: 35% mana | 2.2/5: 44% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw
3:52.545 default R immolate Fluffy_Pillow 375228.2/1100000: 34% mana | 2.4/5: 48% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
3:53.716 default S incinerate Fluffy_Pillow 325763.7/1100000: 30% mana | 2.5/5: 50% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
3:54.724 default S incinerate Fluffy_Pillow 284997.4/1100000: 26% mana | 2.8/5: 56% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
3:55.732 default H conflagrate Fluffy_Pillow 244323.5/1100000: 22% mana | 3.4/5: 68% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
3:56.880 default S incinerate Fluffy_Pillow 260870.9/1100000: 24% mana | 3.9/5: 78% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw
3:57.866 default S incinerate Fluffy_Pillow 220083.2/1100000: 20% mana | 4.3/5: 86% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, mark_of_the_claw
3:58.853 default N dimensional_rift Fluffy_Pillow 179310.0/1100000: 16% mana | 4.6/5: 92% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
4:00.001 default P chaos_bolt Fluffy_Pillow 195857.4/1100000: 18% mana | 4.9/5: 98% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
4:02.294 default F use_items Fluffy_Pillow 228651.7/1100000: 21% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos
4:02.294 default S incinerate Fluffy_Pillow 228651.7/1100000: 21% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos
4:03.731 default H conflagrate Fluffy_Pillow 193943.2/1100000: 18% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, lord_of_flames, embrace_chaos
4:04.904 default P chaos_bolt Fluffy_Pillow 210576.4/1100000: 19% mana | 4.1/5: 82% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:05.870 default L soul_harvest Fluffy_Pillow 224500.4/1100000: 20% mana | 2.1/5: 42% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:05.870 default P chaos_bolt Fluffy_Pillow 224500.4/1100000: 20% mana | 2.1/5: 42% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:06.836 default S incinerate Fluffy_Pillow 238424.5/1100000: 22% mana | 1.1/5: 22% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:08.244 default S incinerate Fluffy_Pillow 203719.5/1100000: 19% mana | 1.5/5: 30% soul_shard soul_harvest, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:09.654 default M channel_demonfire Fluffy_Pillow 169043.4/1100000: 15% mana | 1.9/5: 38% soul_shard soul_harvest, lord_of_flames, embrace_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:12.141 default H conflagrate Fluffy_Pillow 151658.9/1100000: 14% mana | 2.0/5: 40% soul_shard soul_harvest, lord_of_flames, concordance_of_the_legionfall
4:13.315 default D immolate Fluffy_Pillow 168236.7/1100000: 15% mana | 2.5/5: 50% soul_shard soul_harvest, backdraft(2), lord_of_flames, concordance_of_the_legionfall
4:14.486 default P chaos_bolt Fluffy_Pillow 118772.1/1100000: 11% mana | 2.7/5: 54% soul_shard soul_harvest, backdraft(2), lord_of_flames, concordance_of_the_legionfall
4:16.126 default S incinerate Fluffy_Pillow 141930.2/1100000: 13% mana | 0.8/5: 16% soul_shard soul_harvest, backdraft, lord_of_flames, embrace_chaos
4:17.133 default S incinerate Fluffy_Pillow 101151.0/1100000: 9% mana | 1.1/5: 22% soul_shard soul_harvest, lord_of_flames, embrace_chaos, mark_of_the_claw
4:18.541 default H conflagrate Fluffy_Pillow 66446.0/1100000: 6% mana | 1.6/5: 32% soul_shard soul_harvest, lord_of_flames, embrace_chaos, mark_of_the_claw
4:19.794 default N dimensional_rift Fluffy_Pillow 84506.9/1100000: 8% mana | 2.3/5: 46% soul_shard soul_harvest, backdraft(2), lord_of_flames, embrace_chaos, mark_of_the_claw
4:20.941 default S incinerate Fluffy_Pillow 101039.9/1100000: 9% mana | 2.6/5: 52% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw
4:21.928 default S incinerate Fluffy_Pillow 60266.6/1100000: 5% mana | 2.9/5: 58% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, mark_of_the_claw
4:22.914 default T life_tap Fluffy_Pillow 19478.9/1100000: 2% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
4:24.063 default F use_items Fluffy_Pillow 366040.7/1100000: 33% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
4:24.063 default S incinerate Fluffy_Pillow 366040.7/1100000: 33% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
4:25.471 default S incinerate Fluffy_Pillow 331335.8/1100000: 30% mana | 3.8/5: 76% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
4:26.878 default H conflagrate Fluffy_Pillow 296616.5/1100000: 27% mana | 4.3/5: 86% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
4:28.027 default N dimensional_rift Fluffy_Pillow 313178.3/1100000: 28% mana | 4.8/5: 96% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw
4:29.175 default M channel_demonfire Fluffy_Pillow 329647.9/1100000: 30% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
4:31.666 default D immolate Fluffy_Pillow 312022.8/1100000: 28% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
4:32.838 default N dimensional_rift Fluffy_Pillow 262572.3/1100000: 24% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
4:34.010 default H conflagrate Fluffy_Pillow 279121.9/1100000: 25% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
4:35.182 default P chaos_bolt Fluffy_Pillow 295671.4/1100000: 27% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos
4:36.821 default S incinerate Fluffy_Pillow 318815.4/1100000: 29% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, backdraft(3), lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
4:37.828 default S incinerate Fluffy_Pillow 278035.0/1100000: 25% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
4:38.836 default S incinerate Fluffy_Pillow 237268.7/1100000: 22% mana | 3.8/5: 76% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
4:39.842 default S incinerate Fluffy_Pillow 196474.2/1100000: 18% mana | 4.1/5: 82% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity
4:41.279 default P chaos_bolt Fluffy_Pillow 161765.8/1100000: 15% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
4:43.618 default P chaos_bolt Fluffy_Pillow 195143.9/1100000: 18% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, mark_of_the_claw
4:44.994 default Q conflagrate Fluffy_Pillow 214977.7/1100000: 20% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, extracted_sanity, mark_of_the_claw
4:46.144 default R immolate Fluffy_Pillow 231553.9/1100000: 21% mana | 3.5/5: 70% soul_shard backdraft(2), lord_of_flames, embrace_chaos, extracted_sanity, mark_of_the_claw
4:47.293 default O chaos_bolt Fluffy_Pillow 182115.8/1100000: 17% mana | 3.6/5: 72% soul_shard backdraft(2), lord_of_flames, embrace_chaos, extracted_sanity, mark_of_the_claw
4:48.262 default S incinerate Fluffy_Pillow 196083.0/1100000: 18% mana | 1.6/5: 32% soul_shard backdraft, lord_of_flames, embrace_chaos, mark_of_the_claw
4:49.249 default M channel_demonfire Fluffy_Pillow 155068.3/1100000: 14% mana | 2.0/5: 40% soul_shard lord_of_flames, embrace_chaos
4:51.960 default H conflagrate Fluffy_Pillow 140549.7/1100000: 13% mana | 2.2/5: 44% soul_shard lord_of_flames, embrace_chaos
4:53.132 default O chaos_bolt Fluffy_Pillow 157099.3/1100000: 14% mana | 2.7/5: 54% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
4:54.768 default S incinerate Fluffy_Pillow 180422.6/1100000: 16% mana | 0.8/5: 16% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw
4:55.754 default S incinerate Fluffy_Pillow 139634.9/1100000: 13% mana | 1.2/5: 24% soul_shard lord_of_flames, conflagration_of_chaos, embrace_chaos, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 75895 75895 46630
Intellect 61279 59573 49413 (4609)
Spirit 1 1 0
Health 4553700 4553700 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 61279 59573 0
Crit 23.42% 23.42% 7369
Haste 28.37% 27.37% 10264
Damage / Heal Versatility 8.10% 8.10% 3849
ManaReg per Second 14121 14011 0
Mastery 49.40% 49.40% 6681
Armor 2233 2233 2233
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 938.00
Local Head Diabolic Helm
ilevel: 930, stats: { 281 Armor, +4305 Sta, +2870 Int, +1082 Crit, +766 Mastery }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Lessons of Space-Time
ilevel: 970, stats: { 300 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Chest Diabolic Robe
ilevel: 930, stats: { 346 Armor, +4305 Sta, +2870 Int, +1241 Haste, +607 Vers }
Local Waist Feretory of Souls
ilevel: 970, stats: { 225 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Legs Diabolic Leggings
ilevel: 930, stats: { 303 Armor, +4305 Sta, +2870 Int, +1162 Mastery, +686 Haste }
Local Feet Slippers of Enduring Vigilance
ilevel: 930, stats: { 238 Armor, +3229 Sta, +2153 Int, +931 Haste, +455 Mastery }
Local Wrists Oathbreaker's Cuffs
ilevel: 930, stats: { 151 Armor, +2422 Sta, +1615 Int, +676 Crit, +364 Vers }
Local Hands Gloves of Furtive Oppression
ilevel: 930, stats: { 216 Armor, +3229 Sta, +2153 Int, +812 Crit, +574 Mastery }
Local Finger1 Yathae's Thumb Ring
ilevel: 930, stats: { +2422 Sta, +2414 Crit, +1106 Vers }, enchant: { +200 Haste }
Local Finger2 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Diabolic Shroud
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +676 Crit, +364 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 957, weapon: { 9093 - 13641, 3.6 }, stats: { +3691 Int, +5537 Sta, +1024 Haste, +1024 Mastery, +20134 Int }, relics: { +55 ilevels, +55 ilevels, +55 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="T19 4pc - T20 2pc"
spec=destruction
level=110
race=troll
role=spell
position=back
talents=1203012
artifact=38:0:0:0:0:803:1:804:4:805:4:806:4:807:4:808:4:809:4:810:4:811:4:812:4:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1612:1:1713:1

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
actions+=/havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/cataclysm,if=spell_targets.cataclysm>=3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
actions+=/immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/use_items
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest,if=!buff.soul_harvest.remains
actions+=/chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
actions+=/rain_of_fire,if=active_enemies>=3
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=active_enemies<3&target.time_to_die<=10
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=diabolic_helm,id=147183,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant_id=5437
shoulders=lessons_of_spacetime,id=144369,ilevel=970
back=diabolic_shroud,id=147181,ilevel=930,enchant_id=5436
chest=diabolic_robe,id=147185,ilevel=930
wrists=oathbreakers_cuffs,id=147001,ilevel=930
hands=gloves_of_furtive_oppression,id=146988,ilevel=930
waist=feretory_of_souls,id=132456,ilevel=970
legs=diabolic_leggings,id=147184,ilevel=930
feet=slippers_of_enduring_vigilance,id=146987,ilevel=930
finger1=yathaes_thumb_ring,id=147021,ilevel=930,enchant_id=5428
finger2=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant_id=5428
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=scepter_of_sargeras,id=128941,ilevel=957,gem_id=147087/147090/147087

# Gear Summary
# gear_ilvl=938.47
# gear_stamina=46630
# gear_intellect=49413
# gear_crit_rating=7369
# gear_haste_rating=10264
# gear_mastery_rating=6681
# gear_versatility_rating=3849
# gear_armor=2233
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
# set_bonus=tier20_2pc=1
default_pet=imp

T20 2pc : 1315577 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1315577.0 1315577.0 1912.6 / 0.145% 178330.9 / 13.6% 43.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
23025.8 23025.8 Mana 0.00% 46.7 100.0% 100%
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Channel Demonfire (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T20 2pc 1315577
Channel Demonfire 0 (163598) 0.0% (12.4%) 16.1 19.09sec 3057831 1262229

Stats details: channel_demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.07 0.00 240.12 0.00 2.4226 0.1453 0.00 0.00 0.00 1262228.76 1262228.76
 
 

Action details: channel_demonfire

Static Values
  • id:196447
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:52800.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
Spelldata
  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Channel Demonfire (_tick) 163598 12.4% 0.0 0.00sec 0 0 Direct 236.5 166723 333227 207747 24.6%  

Stats details: channel_demonfire_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 236.49 0.00 0.00 0.0000 0.0000 49132254.65 49132254.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.22 75.36% 166722.84 120066 242676 166888.67 158346 194554 29713480 29713480 0.00
crit 58.28 24.64% 333226.90 240155 485243 333558.73 307240 393174 19418775 19418775 0.00
 
 

Action details: channel_demonfire_tick

Static Values
  • id:196448
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Chaos Bolt 355998 27.1% 41.4 7.18sec 2585350 1378590 Direct 42.2 0 2535005 2535005 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.40 42.22 0.00 0.00 1.8754 0.0000 107037842.06 107037842.06 0.00 1378589.73 1378589.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 42.22 100.00% 2535004.97 1825701 3762057 2535863.15 2397493 2695897 107037842 107037842 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=1}} Chaos damage. Damage is further increased by your critical strike chance.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 108702 8.3% 35.3 8.60sec 925973 845733 Direct 35.3 493930 1195445 925964 61.6%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.27 35.27 0.00 0.00 1.0949 0.0000 32657134.01 32657134.01 0.00 845733.00 845733.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.55 38.41% 493930.47 359094 725408 494305.19 446093 563969 6691549 6691549 0.00
crit 21.72 61.59% 1195444.99 718354 1824953 1196336.00 1062873 1337320 25965585 25965585 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 6561 0.5% 13.8 2.12sec 139893 0 Direct 13.8 112575 225135 139912 24.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.85 13.85 0.00 0.00 0.0000 0.0000 1937271.68 1937271.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.49 75.73% 112574.98 98855 130488 112606.97 98855 127523 1180541 1180541 0.00
crit 3.36 24.27% 225135.27 197709 260976 219372.10 0 260976 756731 756731 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 110150 8.4% 17.2 17.95sec 1929846 1726486 Direct 17.2 269406 537982 424259 57.7%  
Periodic 136.2 120563 240859 189852 57.6% 98.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.17 17.17 136.18 136.18 1.1178 2.1816 33138162.77 33138162.77 0.00 104775.10 1726485.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.27 42.34% 269406.29 198360 400482 269435.66 233938 316771 1958716 1958716 0.00
crit 9.90 57.66% 537981.88 396638 801158 538153.37 467860 614678 5326308 5326308 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.7 42.40% 120562.72 236 179429 120643.52 113305 128566 6961699 6961699 0.00
crit 78.4 57.60% 240859.12 282 358864 241022.01 227763 254949 18891440 18891440 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 165547 12.6% 90.1 3.23sec 553090 479687 Direct 89.7 441953 881201 555339 25.8%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.08 89.71 0.00 0.00 1.1530 0.0000 49822159.60 49822159.60 0.00 479686.51 479686.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.56 74.19% 441952.92 330266 667475 442277.16 421020 466811 29414711 29414711 0.00
crit 23.16 25.81% 881201.06 660509 1334776 881998.56 807788 984215 20407449 20407449 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:55000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.84
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Insidious Corruption 13590 1.0% 5.1 60.55sec 806287 0 Periodic 42.8 76917 153979 95626 24.3% 19.8%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.08 0.00 42.79 42.79 0.0000 1.3955 4092141.00 4092141.00 0.00 68525.56 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.4 75.72% 76916.91 1309 103505 76887.07 72909 82676 2492409 2492409 0.00
crit 10.4 24.28% 153978.81 2618 207010 153941.25 114943 172508 1599732 1599732 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Spectral Owl 0 (73555) 0.0% (5.6%) 3.0 120.48sec 7301905 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 0.00 57.50 0.00 0.0000 1.0000 0.00 0.00 0.00 382399.61 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 22731 1.7% 33.1 7.99sec 205066 0 Direct 32.9 166484 332513 206433 24.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.13 32.91 0.00 0.00 0.0000 0.0000 6794112.76 6794112.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.00 75.94% 166484.19 138719 183108 166530.54 155617 178874 4161459 4161459 0.00
crit 7.92 24.06% 332513.26 277437 366217 332402.10 0 366217 2632654 2632654 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
    Spectral Bolt 50824 3.8% 85.9 3.04sec 176919 0 Direct 85.5 143185 286588 177684 24.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.88 85.51 0.00 0.00 0.0000 0.0000 15193482.54 15193482.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.94 75.94% 143185.08 118901 156949 143207.19 137311 149449 9298485 9298485 0.00
crit 20.57 24.06% 286588.32 237802 313898 286670.87 263280 311520 5894997 5894997 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90466.53
  • base_dd_max:99989.32
 
pet - infernal 108124 / 1161
Immolation 45466 0.0% 1.0 0.00sec 144451 0 Periodic 2.0 58280 116522 72235 23.9% 0.9%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 2.00 2.00 0.0000 1.3638 144450.86 144450.86 0.00 52970.61 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.5 76.05% 58279.63 57050 60799 54841.51 0 60799 88644 88644 0.00
crit 0.5 23.95% 116522.16 114100 121599 48942.83 0 121599 55807 55807 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 27436 0.0% 2.0 1.19sec 43602 31792 Direct 2.0 34893 69889 43607 24.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.3715 0.0000 87204.68 128199.13 31.98 31791.72 31791.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.50 75.11% 34893.43 34116 36358 32405.32 0 36358 52416 77057 29.68
crit 0.50 24.89% 69888.84 68232 72716 29782.00 0 72716 34788 51142 13.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Meteor Strike 35222 0.0% 1.0 0.00sec 111886 0 Direct 1.0 89688 179105 111899 24.8%  

Stats details: meteor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 111885.88 111885.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.75 75.17% 89687.73 87769 93537 67417.67 0 93537 67418 67418 0.00
crit 0.25 24.83% 179104.97 175538 187075 44468.21 0 187075 44468 44468 0.00
 
 

Action details: meteor_strike

Static Values
  • id:171018
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time>1
Spelldata
  • id:171018
  • name:Meteor Strike
  • school:fire
  • tooltip:Stunned.
  • description:The abyssal releases a powerful burst of flames, dealing {$s1=0} Fire damage to nearby targets, and stunning them for {$d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - doomguard 155322 / 153626
Doom Bolt 155322 11.7% 134.3 2.22sec 344271 155759 Direct 133.5 276085 550796 346252 25.5%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.27 133.50 0.00 0.00 2.2103 0.0000 46223916.20 46223916.20 0.00 155758.80 155758.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.40 74.46% 276085.39 240339 406790 276204.30 263447 287423 27442023 27442023 0.00
crit 34.10 25.54% 550795.95 480678 813580 551004.40 516908 597135 18781894 18781894 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 329874 / 27901
Immolation 206191 1.3% 3.0 0.00sec 1718324 0 Periodic 66.0 62900 125807 78109 24.2% 24.5%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 66.00 66.00 0.0000 1.1195 5154970.50 5154970.50 0.00 69768.30 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.0 75.82% 62900.11 51863 72959 62900.35 58696 68874 3147699 3147699 0.00
crit 16.0 24.18% 125806.52 103727 145918 125795.07 109720 142602 2007271 2007271 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 123684 0.8% 66.0 1.12sec 46852 41851 Direct 66.0 37669 75363 46853 24.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.00 66.00 0.00 0.00 1.1195 0.0000 3092216.39 4545850.99 31.98 41850.61 41850.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.92 75.64% 37669.13 31015 43630 37666.32 34948 40906 1880352 2764296 31.98
crit 16.08 24.36% 75362.69 62029 87260 75342.63 67239 85796 1211864 1781555 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 173143 / 25455
Shadow Bolt 173143 1.9% 3.5 68.40sec 2168073 0 Periodic 35.3 172140 344021 215585 25.3% 16.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.52 0.00 35.55 35.35 0.0000 1.3523 7620782.27 7620782.27 0.00 158508.72 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.4 74.72% 172139.52 1278 224492 171713.90 0 217380 4546772 4546772 0.00
crit 8.9 25.28% 344020.64 1159 448983 341005.26 0 448983 3074010 3074010 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 239368 / 69299
Searing Bolt 239368 5.2% 68.9 2.58sec 298379 826927 Direct 68.5 90867 0 90867 0.0%  
Periodic 108.6 105323 209946 131985 25.5% 35.5%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.91 68.53 108.61 108.61 0.3608 0.9847 20561539.02 20561539.02 0.00 155986.67 826926.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.53 100.00% 90866.58 76514 112247 90933.54 0 112247 6226306 6226306 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.9 74.52% 105323.03 223 157176 105150.15 0 123833 8524069 8524069 0.00
crit 27.7 25.48% 209946.24 1071 314352 209385.28 0 284244 5811165 5811165 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=20 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.070000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 368147 / 20657
Chaos Bolt 368147 1.6% 3.4 69.68sec 1804521 810121 Direct 3.4 0 1813544 1813544 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.45 3.43 0.00 0.00 2.2277 0.0000 6220106.41 6220106.41 0.00 810120.66 810120.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.43 100.00% 1813544.17 1662034 2261471 1812223.82 0 2261471 6220106 6220106 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:8.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 373134 / 23389
Chaos Barrage 373134 1.8% 3.6 68.14sec 1963998 0 Periodic 112.2 50024 99670 62583 25.3% 6.5%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 112.60 112.21 0.0000 0.1730 7022462.45 7022462.45 0.00 360459.01 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.8 74.70% 50024.39 397 61736 49868.43 44134 61736 4193320 4193320 0.00
crit 28.4 25.30% 99670.08 912 123473 99458.49 72539 123473 2829143 2829143 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
T20 2pc
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T20 2pc
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.53sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.7 23.92sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.68 0.00 0.00 0.00 1.1170 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target. |cFFFFFFFFGenerates {$s2=3} Soul Shard Fragments.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T20 2pc
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T20 2pc
  • harmful:false
  • if_expr:
 
Life Tap 5.0 41.63sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.95 0.00 0.00 0.00 1.1565 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 3.0 121.50sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.soul_harvest.remains
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7765 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Backdraft 32.6 2.6 9.3sec 8.6sec 48.96% 41.99% 0.0(0.0) 2.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:16.09%
  • backdraft_2:30.10%
  • backdraft_3:1.14%
  • backdraft_4:1.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Berserking 2.1 0.0 180.5sec 180.5sec 6.89% 10.83% 0.0(0.0) 2.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.4 3.1 35.2sec 25.0sec 32.46% 32.46% 3.1(3.1) 8.1

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagration of Chaos 17.6 0.0 17.0sec 17.0sec 52.83% 48.43% 0.0(0.0) 0.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:52.83%

Trigger Attempt Success

  • trigger_pct:49.94%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a {$h=50}% chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Extracted Sanity 5.1 0.0 60.3sec 60.3sec 19.17% 19.17% 0.0(0.0) 4.7

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lessons of Space-Time 10.5 3.2 29.7sec 23.8sec 38.25% 38.25% 3.2(3.2) 10.1

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_lessons_of_spacetime
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • lessons_of_spacetime_1:38.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:236176
  • name:Lessons of Space-Time
  • tooltip:You and your minions deal {$s1=10}% increased damage.
  • description:{$@spelldesc236174=While you have a Dimensional Rift open, all of your damage is increased by {$236176s1=10}%.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 99.63% 99.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.1 4.1 22.9sec 17.2sec 29.99% 29.99% 4.1(4.1) 12.8

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.15% 10.15% 0.0(0.0) 1.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.62% 19.62% 0.0(0.0) 1.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 3.0 0.0 121.5sec 121.5sec 13.44% 100.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • soul_harvest_1:13.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.4 69.1sec
flame_rift 3.4 68.5sec
chaos_tear 3.4 70.0sec
chaos_portal 3.5 68.5sec
dimension_ripper 4.5 50.9sec

Resources

Resource Usage Type Count Total Average RPE APR
T20 2pc
channel_demonfire Mana 28.8 1518198.4 52800.0 94487.7 32.4
chaos_bolt Soul Shard 75.9 151.8 2.0 3.7 705312.4
immolate Mana 30.7 2028094.5 66000.0 118108.8 16.3
incinerate Mana 161.2 8866023.6 55000.0 98424.2 5.6
summon_doomguard Soul Shard 1.8 1.8 1.0 1.8 0.0
pet - doomguard
doom_bolt Energy 134.3 4699.3 35.0 35.0 9836.4
pet - flame_rift
searing_bolt Energy 67.1 67.1 1.0 1.0 306445.9
Resource Gains Type Count Total Average Overflow
life_tap Mana 8.87 2926062.99 (26.94%) 330000.00 0.00 0.00%
immolate Soul Shard 243.69 23.07 (15.27%) 0.09 1.30 5.32%
dimensional_rift Soul Shard 24.48 6.94 (4.60%) 0.28 0.40 5.46%
conflagrate Soul Shard 63.11 30.85 (20.42%) 0.49 0.71 2.24%
incinerate Soul Shard 161.20 31.86 (21.08%) 0.20 0.38 1.19%
mp5_regen Mana 1345.55 7935365.01 (73.06%) 5897.49 122167.67 1.52%
immolate_crits Soul Shard 70.06 6.67 (4.42%) 0.10 0.33 4.76%
soulsnatcher Soul Shard 11.47 11.47 (7.59%) 1.00 0.00 0.00%
feretory_of_souls Soul Shard 21.46 20.26 (13.41%) 0.94 1.21 5.62%
incinerate_crits Soul Shard 41.59 4.10 (2.71%) 0.10 0.06 1.48%
destruction_t20_2pc Soul Shard 161.20 15.87 (10.51%) 0.10 0.25 1.53%
pet - doomguard
energy_regen Energy 240.27 8346.89 (100.00%) 34.74 278.69 3.23%
Resource RPS-Gain RPS-Loss
Health 0.00 7490.10
Mana 20148.73 23025.84
Soul Shard 0.28 0.28
Combat End Resource Mean Min Max
Mana 233871.12 7232.52 507572.33
Soul Shard 1.59 0.00 4.60

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.8%

Statistics & Data Analysis

Fight Length
Sample Data T20 2pc Fight Length
Count 2497
Mean 301.23
Minimum 218.33
Maximum 422.70
Spread ( max - min ) 204.37
Range [ ( max - min ) / 2 * 100% ] 33.92%
Standard Deviation 41.1847
5th Percentile 240.67
95th Percentile 367.33
( 95th Percentile - 5th Percentile ) 126.66
Mean Distribution
Standard Deviation 0.8242
95.00% Confidence Intervall ( 299.61 - 302.85 )
Normalized 95.00% Confidence Intervall ( 99.46% - 100.54% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 719
0.1% Error 71808
0.1 Scale Factor Error with Delta=300 15
0.05 Scale Factor Error with Delta=300 58
0.01 Scale Factor Error with Delta=300 1448
DPS
Sample Data T20 2pc Damage Per Second
Count 2497
Mean 1315577.00
Minimum 1114048.18
Maximum 1510210.33
Spread ( max - min ) 396162.15
Range [ ( max - min ) / 2 * 100% ] 15.06%
Standard Deviation 48761.6454
5th Percentile 1240062.36
95th Percentile 1394668.07
( 95th Percentile - 5th Percentile ) 154605.72
Mean Distribution
Standard Deviation 975.8186
95.00% Confidence Intervall ( 1313664.43 - 1317489.57 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5278
0.1 Scale Factor Error with Delta=300 20297399
0.05 Scale Factor Error with Delta=300 81189593
0.01 Scale Factor Error with Delta=300 2029739821
Priority Target DPS
Sample Data T20 2pc Priority Target Damage Per Second
Count 2497
Mean 1315577.00
Minimum 1114048.18
Maximum 1510210.33
Spread ( max - min ) 396162.15
Range [ ( max - min ) / 2 * 100% ] 15.06%
Standard Deviation 48761.6454
5th Percentile 1240062.36
95th Percentile 1394668.07
( 95th Percentile - 5th Percentile ) 154605.72
Mean Distribution
Standard Deviation 975.8186
95.00% Confidence Intervall ( 1313664.43 - 1317489.57 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5278
0.1 Scale Factor Error with Delta=300 20297399
0.05 Scale Factor Error with Delta=300 81189593
0.01 Scale Factor Error with Delta=300 2029739821
DPS(e)
Sample Data T20 2pc Damage Per Second (Effective)
Count 2497
Mean 1315577.00
Minimum 1114048.18
Maximum 1510210.33
Spread ( max - min ) 396162.15
Range [ ( max - min ) / 2 * 100% ] 15.06%
Damage
Sample Data T20 2pc Damage
Count 2497
Mean 299804561.06
Minimum 221744405.60
Maximum 375392082.50
Spread ( max - min ) 153647676.91
Range [ ( max - min ) / 2 * 100% ] 25.62%
DTPS
Sample Data T20 2pc Damage Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T20 2pc Healing Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T20 2pc Healing Per Second (Effective)
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T20 2pc Heal
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T20 2pc Healing Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T20 2pc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data T20 2pcTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T20 2pc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
0.00 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
C 1.11 dimensional_rift,if=charges=3
0.00 cataclysm,if=spell_targets.cataclysm>=3
D 6.18 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
0.00 immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
E 2.08 berserking
0.00 blood_fury
F 8.09 use_items
G 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
H 18.28 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
I 0.69 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
J 1.20 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
0.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
K 1.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
L 2.97 soul_harvest,if=!buff.soul_harvest.remains
0.00 chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
M 16.07 channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
0.00 rain_of_fire,if=active_enemies>=3
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
N 11.37 dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
O 1.88 chaos_bolt,if=active_enemies<3&target.time_to_die<=10
P 39.73 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
0.00 shadowburn
Q 16.30 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
R 11.05 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
S 90.37 incinerate
T 4.95 life_tap

Sample Sequence

0136ABCDEFHHKLMNPQPSSSSPHRSMSSFHSSSPSSQSPRMSHSSSPPQNPSSMRHPSSSSSQSSPRMHSSSPSHFPPSRSTHMNSSSSQSPSRSSPMQPSHSNPFRLGPSPQMPNQSSSSTDFSPQSMPPQPRSSHSSSSMPQSRSTNEPHSSSPMHSSRSPHSPPFSNHMRSSSHSPSTSCNPMQRSHSPSSSFSHJLPMDPHPSPNSSQSFRSMNPHSSTSSQPORSMQO

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T20 2pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food T20 2pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_infernal Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation T20 2pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:00.000 default C dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/5: 40% soul_shard concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:01.148 default D immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.3/5: 46% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.033 default E berserking Fluffy_Pillow 1034093.7/1100000: 94% mana | 2.3/5: 46% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.033 default F use_items Fluffy_Pillow 1034093.7/1100000: 94% mana | 2.3/5: 46% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.033 default H conflagrate Fluffy_Pillow 1034093.7/1100000: 94% mana | 2.3/5: 46% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.801 default H conflagrate Fluffy_Pillow 1050643.4/1100000: 96% mana | 2.8/5: 56% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.573 default K summon_doomguard Fluffy_Pillow 1067279.3/1100000: 97% mana | 4.3/5: 86% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.342 default L soul_harvest Fluffy_Pillow 1083850.5/1100000: 99% mana | 3.4/5: 68% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.342 default M channel_demonfire Fluffy_Pillow 1083850.5/1100000: 99% mana | 3.4/5: 68% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.184 default N dimensional_rift Fluffy_Pillow 1070663.3/1100000: 97% mana | 3.5/5: 70% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.971 default P chaos_bolt Fluffy_Pillow 1087277.3/1100000: 99% mana | 3.9/5: 78% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.069 default Q conflagrate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.9/5: 38% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.987 default P chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.5/5: 50% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.084 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.6/5: 12% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.837 default S incinerate Fluffy_Pillow 1046752.2/1100000: 95% mana | 0.9/5: 18% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.802 default S incinerate Fluffy_Pillow 1012123.9/1100000: 92% mana | 1.3/5: 26% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.765 default S incinerate Fluffy_Pillow 975437.7/1100000: 89% mana | 1.6/5: 32% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.871 default P chaos_bolt Fluffy_Pillow 940740.6/1100000: 86% mana | 2.1/5: 42% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:15.672 default H conflagrate Fluffy_Pillow 973801.5/1100000: 89% mana | 1.2/5: 24% soul_shard bloodlust, soul_harvest, lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.574 default R immolate Fluffy_Pillow 990359.6/1100000: 90% mana | 1.7/5: 34% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.476 default S incinerate Fluffy_Pillow 940917.6/1100000: 86% mana | 1.8/5: 36% soul_shard bloodlust, soul_harvest, backdraft(2), lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.250 default M channel_demonfire Fluffy_Pillow 900125.9/1100000: 82% mana | 2.1/5: 42% soul_shard bloodlust, soul_harvest, backdraft, lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:20.283 default S incinerate Fluffy_Pillow 884645.7/1100000: 80% mana | 2.2/5: 44% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_prolonged_power
0:21.057 default S incinerate Fluffy_Pillow 843854.0/1100000: 77% mana | 2.6/5: 52% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:22.164 default F use_items Fluffy_Pillow 809175.2/1100000: 74% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:22.164 default H conflagrate Fluffy_Pillow 809175.2/1100000: 74% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:23.066 default S incinerate Fluffy_Pillow 825733.2/1100000: 75% mana | 3.5/5: 70% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:23.839 default S incinerate Fluffy_Pillow 784923.2/1100000: 71% mana | 3.8/5: 76% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:24.616 default S incinerate Fluffy_Pillow 744186.6/1100000: 68% mana | 4.3/5: 86% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:25.722 default P chaos_bolt Fluffy_Pillow 709489.4/1100000: 64% mana | 4.7/5: 94% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:27.525 default S incinerate Fluffy_Pillow 742587.1/1100000: 68% mana | 2.9/5: 58% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:28.631 default S incinerate Fluffy_Pillow 707890.0/1100000: 64% mana | 3.2/5: 64% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:29.737 default Q conflagrate Fluffy_Pillow 673192.8/1100000: 61% mana | 3.7/5: 74% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:30.639 default S incinerate Fluffy_Pillow 689750.8/1100000: 63% mana | 4.2/5: 84% soul_shard bloodlust, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:31.416 default P chaos_bolt Fluffy_Pillow 649014.2/1100000: 59% mana | 4.6/5: 92% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_prolonged_power
0:32.678 default R immolate Fluffy_Pillow 672180.8/1100000: 61% mana | 2.6/5: 52% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:33.582 default M channel_demonfire Fluffy_Pillow 622777.8/1100000: 57% mana | 2.7/5: 54% soul_shard bloodlust, lord_of_flames, mark_of_the_claw, potion_of_prolonged_power
0:35.530 default S incinerate Fluffy_Pillow 606480.1/1100000: 55% mana | 2.8/5: 56% soul_shard bloodlust, lord_of_flames, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.614 default H conflagrate Fluffy_Pillow 571792.4/1100000: 52% mana | 3.2/5: 64% soul_shard bloodlust, lord_of_flames, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:37.500 default S incinerate Fluffy_Pillow 588394.6/1100000: 53% mana | 3.7/5: 74% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:38.259 default S incinerate Fluffy_Pillow 547617.0/1100000: 50% mana | 4.1/5: 82% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.019 default S incinerate Fluffy_Pillow 506858.1/1100000: 46% mana | 4.4/5: 88% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:40.104 default P chaos_bolt Fluffy_Pillow 472046.6/1100000: 43% mana | 4.9/5: 98% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.870 default P chaos_bolt Fluffy_Pillow 497501.9/1100000: 45% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:44.164 default Q conflagrate Fluffy_Pillow 530567.9/1100000: 48% mana | 1.1/5: 22% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:45.313 default N dimensional_rift Fluffy_Pillow 547129.7/1100000: 50% mana | 1.6/5: 32% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:46.461 default P chaos_bolt Fluffy_Pillow 563527.2/1100000: 51% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.102 default S incinerate Fluffy_Pillow 586699.4/1100000: 53% mana | 1.0/5: 20% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.109 default S incinerate Fluffy_Pillow 545919.0/1100000: 50% mana | 1.5/5: 30% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.545 default M channel_demonfire Fluffy_Pillow 511196.4/1100000: 46% mana | 1.8/5: 36% soul_shard lessons_of_spacetime, lord_of_flames, potion_of_prolonged_power
0:53.100 default R immolate Fluffy_Pillow 494475.0/1100000: 45% mana | 1.9/5: 38% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.273 default H conflagrate Fluffy_Pillow 445038.7/1100000: 40% mana | 2.1/5: 42% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.447 default P chaos_bolt Fluffy_Pillow 461616.5/1100000: 42% mana | 2.6/5: 52% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.086 default S incinerate Fluffy_Pillow 484760.4/1100000: 44% mana | 0.8/5: 16% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.094 default S incinerate Fluffy_Pillow 443994.2/1100000: 40% mana | 1.3/5: 26% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
0:59.532 default S incinerate Fluffy_Pillow 409299.8/1100000: 37% mana | 1.7/5: 34% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
1:00.970 default S incinerate Fluffy_Pillow 374790.0/1100000: 34% mana | 2.1/5: 42% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:02.379 default S incinerate Fluffy_Pillow 340099.5/1100000: 31% mana | 2.4/5: 48% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:03.786 default Q conflagrate Fluffy_Pillow 305380.1/1100000: 28% mana | 2.8/5: 56% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:04.935 default S incinerate Fluffy_Pillow 321941.9/1100000: 29% mana | 3.3/5: 66% soul_shard backdraft(2), lord_of_flames, mark_of_the_claw
1:05.922 default S incinerate Fluffy_Pillow 281168.7/1100000: 26% mana | 3.8/5: 76% soul_shard backdraft, lord_of_flames, mark_of_the_claw
1:06.909 default P chaos_bolt Fluffy_Pillow 240228.8/1100000: 22% mana | 5.0/5: 100% soul_shard lord_of_flames
1:09.249 default R immolate Fluffy_Pillow 273272.6/1100000: 25% mana | 3.0/5: 60% soul_shard lord_of_flames, mark_of_the_claw
1:10.395 default M channel_demonfire Fluffy_Pillow 223791.1/1100000: 20% mana | 3.1/5: 62% soul_shard lord_of_flames, mark_of_the_claw
1:12.923 default H conflagrate Fluffy_Pillow 207430.0/1100000: 19% mana | 3.2/5: 64% soul_shard lord_of_flames, mark_of_the_claw
1:14.073 default S incinerate Fluffy_Pillow 224006.2/1100000: 20% mana | 3.7/5: 74% soul_shard backdraft(2), lord_of_flames, mark_of_the_claw
1:15.059 default S incinerate Fluffy_Pillow 183218.5/1100000: 17% mana | 4.1/5: 82% soul_shard backdraft, lord_of_flames, mark_of_the_claw
1:16.046 default S incinerate Fluffy_Pillow 142445.2/1100000: 13% mana | 4.5/5: 90% soul_shard lord_of_flames, mark_of_the_claw
1:17.454 default P chaos_bolt Fluffy_Pillow 107740.3/1100000: 10% mana | 5.0/5: 100% soul_shard lord_of_flames, mark_of_the_claw
1:19.748 default S incinerate Fluffy_Pillow 140806.3/1100000: 13% mana | 3.0/5: 60% soul_shard lord_of_flames, mark_of_the_claw
1:21.157 default H conflagrate Fluffy_Pillow 105825.9/1100000: 10% mana | 3.4/5: 68% soul_shard lord_of_flames, concordance_of_the_legionfall
1:22.330 default F use_items Fluffy_Pillow 122389.6/1100000: 11% mana | 3.9/5: 78% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall
1:22.330 default P chaos_bolt Fluffy_Pillow 122389.6/1100000: 11% mana | 3.9/5: 78% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall
1:23.970 default P chaos_bolt Fluffy_Pillow 145547.7/1100000: 13% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, concordance_of_the_legionfall
1:25.609 default S incinerate Fluffy_Pillow 168691.6/1100000: 15% mana | 0.0/5: 0% soul_shard lord_of_flames, concordance_of_the_legionfall
1:27.047 default R immolate Fluffy_Pillow 133997.3/1100000: 12% mana | 0.4/5: 8% soul_shard lord_of_flames, concordance_of_the_legionfall
1:28.220 default S incinerate Fluffy_Pillow 84562.4/1100000: 8% mana | 0.5/5: 10% soul_shard lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
1:29.629 default T life_tap Fluffy_Pillow 49871.9/1100000: 5% mana | 0.8/5: 16% soul_shard lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
1:30.778 default H conflagrate Fluffy_Pillow 396433.7/1100000: 36% mana | 1.0/5: 20% soul_shard lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
1:31.928 default M channel_demonfire Fluffy_Pillow 413009.9/1100000: 38% mana | 1.5/5: 30% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
1:34.466 default N dimensional_rift Fluffy_Pillow 396719.3/1100000: 36% mana | 1.6/5: 32% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
1:35.638 default S incinerate Fluffy_Pillow 413268.8/1100000: 38% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
1:36.645 default S incinerate Fluffy_Pillow 372488.5/1100000: 34% mana | 2.3/5: 46% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
1:37.653 default S incinerate Fluffy_Pillow 331722.2/1100000: 30% mana | 2.8/5: 56% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
1:39.090 default S incinerate Fluffy_Pillow 297013.8/1100000: 27% mana | 3.1/5: 62% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
1:40.526 default Q conflagrate Fluffy_Pillow 262291.2/1100000: 24% mana | 3.6/5: 72% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
1:41.699 default S incinerate Fluffy_Pillow 278854.9/1100000: 25% mana | 4.1/5: 82% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity
1:42.707 default P chaos_bolt Fluffy_Pillow 238088.6/1100000: 22% mana | 4.6/5: 92% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
1:44.347 default S incinerate Fluffy_Pillow 261259.9/1100000: 24% mana | 2.7/5: 54% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
1:45.756 default R immolate Fluffy_Pillow 226569.3/1100000: 21% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
1:46.904 default S incinerate Fluffy_Pillow 177116.7/1100000: 16% mana | 4.1/5: 82% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:48.313 default S incinerate Fluffy_Pillow 142426.2/1100000: 13% mana | 4.5/5: 90% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:49.722 default P chaos_bolt Fluffy_Pillow 107735.7/1100000: 10% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:52.016 default M channel_demonfire Fluffy_Pillow 140298.9/1100000: 13% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos
1:54.600 default Q conflagrate Fluffy_Pillow 123987.0/1100000: 11% mana | 4.2/5: 84% soul_shard lord_of_flames, conflagration_of_chaos
1:55.773 default P chaos_bolt Fluffy_Pillow 140550.6/1100000: 13% mana | 4.7/5: 94% soul_shard backdraft(2), lord_of_flames
1:57.410 default S incinerate Fluffy_Pillow 164112.8/1100000: 15% mana | 2.8/5: 56% soul_shard backdraft, lord_of_flames, mark_of_the_claw
1:58.397 default H conflagrate Fluffy_Pillow 123339.5/1100000: 11% mana | 3.3/5: 66% soul_shard lord_of_flames, mark_of_the_claw
1:59.545 default S incinerate Fluffy_Pillow 139886.9/1100000: 13% mana | 3.8/5: 76% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw
2:00.532 default N dimensional_rift Fluffy_Pillow 99113.6/1100000: 9% mana | 4.3/5: 86% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
2:01.680 default P chaos_bolt Fluffy_Pillow 115661.0/1100000: 11% mana | 4.6/5: 92% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
2:03.285 default F use_items Fluffy_Pillow 138795.7/1100000: 13% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
2:03.285 default R immolate Fluffy_Pillow 138795.7/1100000: 13% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
2:04.435 default L soul_harvest Fluffy_Pillow 89310.0/1100000: 8% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
2:04.435 default G potion Fluffy_Pillow 89310.0/1100000: 8% mana | 2.7/5: 54% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
2:04.435 default P chaos_bolt Fluffy_Pillow 89310.0/1100000: 8% mana | 2.7/5: 54% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:06.776 default S incinerate Fluffy_Pillow 122861.0/1100000: 11% mana | 1.9/5: 38% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_deadly_grace
2:08.184 default P chaos_bolt Fluffy_Pillow 88156.0/1100000: 8% mana | 2.5/5: 50% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_deadly_grace
2:10.477 default Q conflagrate Fluffy_Pillow 121207.6/1100000: 11% mana | 0.6/5: 12% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_deadly_grace
2:11.626 default M channel_demonfire Fluffy_Pillow 137769.4/1100000: 13% mana | 2.1/5: 42% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_deadly_grace
2:14.268 default P chaos_bolt Fluffy_Pillow 123051.5/1100000: 11% mana | 2.3/5: 46% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_deadly_grace
2:15.876 default N dimensional_rift Fluffy_Pillow 146229.4/1100000: 13% mana | 1.5/5: 30% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_deadly_grace
2:17.025 default Q conflagrate Fluffy_Pillow 162629.2/1100000: 15% mana | 1.9/5: 38% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:18.196 default S incinerate Fluffy_Pillow 179164.7/1100000: 16% mana | 2.4/5: 48% soul_shard soul_harvest, lessons_of_spacetime, backdraft(3), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:19.203 default S incinerate Fluffy_Pillow 138384.3/1100000: 13% mana | 2.8/5: 56% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:20.211 default S incinerate Fluffy_Pillow 97618.0/1100000: 9% mana | 3.2/5: 64% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:21.218 default S incinerate Fluffy_Pillow 56837.6/1100000: 5% mana | 3.5/5: 70% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:22.656 default T life_tap Fluffy_Pillow 22143.3/1100000: 2% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:23.829 default D immolate Fluffy_Pillow 368707.0/1100000: 34% mana | 4.1/5: 82% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:25.001 default F use_items Fluffy_Pillow 319256.5/1100000: 29% mana | 4.1/5: 82% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:25.001 default S incinerate Fluffy_Pillow 319256.5/1100000: 29% mana | 4.1/5: 82% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:26.438 default P chaos_bolt Fluffy_Pillow 284548.1/1100000: 26% mana | 4.6/5: 92% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:28.778 default Q conflagrate Fluffy_Pillow 317590.7/1100000: 29% mana | 2.7/5: 54% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:29.951 default S incinerate Fluffy_Pillow 334154.4/1100000: 30% mana | 3.2/5: 64% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:30.960 default M channel_demonfire Fluffy_Pillow 293402.2/1100000: 27% mana | 4.6/5: 92% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:33.603 default P chaos_bolt Fluffy_Pillow 277923.4/1100000: 25% mana | 4.7/5: 94% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:35.242 default P chaos_bolt Fluffy_Pillow 301067.4/1100000: 27% mana | 2.7/5: 54% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
2:37.582 default Q conflagrate Fluffy_Pillow 334110.0/1100000: 30% mana | 1.8/5: 36% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
2:38.753 default P chaos_bolt Fluffy_Pillow 350645.4/1100000: 32% mana | 2.5/5: 50% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity
2:40.394 default R immolate Fluffy_Pillow 373817.6/1100000: 34% mana | 0.6/5: 12% soul_shard backdraft, lord_of_flames, concordance_of_the_legionfall, extracted_sanity
2:41.567 default S incinerate Fluffy_Pillow 324381.3/1100000: 29% mana | 0.6/5: 12% soul_shard backdraft, lord_of_flames, extracted_sanity
2:42.574 default S incinerate Fluffy_Pillow 283600.9/1100000: 26% mana | 2.0/5: 40% soul_shard lord_of_flames, extracted_sanity
2:44.010 default H conflagrate Fluffy_Pillow 248878.3/1100000: 23% mana | 2.3/5: 46% soul_shard lord_of_flames, extracted_sanity
2:45.376 default S incinerate Fluffy_Pillow 268167.3/1100000: 24% mana | 2.9/5: 58% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity
2:46.383 default S incinerate Fluffy_Pillow 227386.9/1100000: 21% mana | 3.2/5: 64% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
2:47.390 default S incinerate Fluffy_Pillow 186606.5/1100000: 17% mana | 3.8/5: 76% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
2:48.827 default S incinerate Fluffy_Pillow 151898.1/1100000: 14% mana | 4.1/5: 82% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
2:50.264 default M channel_demonfire Fluffy_Pillow 117189.6/1100000: 11% mana | 4.7/5: 94% soul_shard lord_of_flames, conflagration_of_chaos
2:53.076 default P chaos_bolt Fluffy_Pillow 104097.2/1100000: 9% mana | 4.9/5: 98% soul_shard lord_of_flames, conflagration_of_chaos
2:55.417 default Q conflagrate Fluffy_Pillow 137154.0/1100000: 12% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
2:56.588 default S incinerate Fluffy_Pillow 153775.3/1100000: 14% mana | 3.6/5: 72% soul_shard backdraft(2), lord_of_flames, mark_of_the_claw
2:57.576 default R immolate Fluffy_Pillow 113016.5/1100000: 10% mana | 3.9/5: 78% soul_shard backdraft, lord_of_flames, mark_of_the_claw
2:58.724 default S incinerate Fluffy_Pillow 63563.9/1100000: 6% mana | 4.0/5: 80% soul_shard backdraft, lord_of_flames, mark_of_the_claw
2:59.711 default T life_tap Fluffy_Pillow 22790.6/1100000: 2% mana | 4.4/5: 88% soul_shard lord_of_flames, mark_of_the_claw
3:00.859 default N dimensional_rift Fluffy_Pillow 369338.0/1100000: 34% mana | 4.4/5: 88% soul_shard lord_of_flames, mark_of_the_claw
3:02.009 default E berserking Fluffy_Pillow 385914.2/1100000: 35% mana | 4.8/5: 96% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
3:02.033 default P chaos_bolt Fluffy_Pillow 386260.2/1100000: 35% mana | 4.8/5: 96% soul_shard berserking, lessons_of_spacetime, lord_of_flames, mark_of_the_claw
3:04.027 default H conflagrate Fluffy_Pillow 418728.9/1100000: 38% mana | 2.9/5: 58% soul_shard berserking, lessons_of_spacetime, lord_of_flames
3:05.049 default S incinerate Fluffy_Pillow 435325.0/1100000: 40% mana | 3.4/5: 68% soul_shard berserking, lessons_of_spacetime, backdraft(2), lord_of_flames
3:05.926 default S incinerate Fluffy_Pillow 394566.5/1100000: 36% mana | 3.8/5: 76% soul_shard berserking, lessons_of_spacetime, backdraft, lord_of_flames
3:06.803 default S incinerate Fluffy_Pillow 353808.0/1100000: 32% mana | 4.1/5: 82% soul_shard berserking, lessons_of_spacetime, lord_of_flames
3:08.054 default P chaos_bolt Fluffy_Pillow 319122.9/1100000: 29% mana | 4.6/5: 92% soul_shard berserking, lessons_of_spacetime, lord_of_flames
3:10.092 default M channel_demonfire Fluffy_Pillow 352217.7/1100000: 32% mana | 2.7/5: 54% soul_shard berserking, lessons_of_spacetime, lord_of_flames
3:12.377 default H conflagrate Fluffy_Pillow 335795.0/1100000: 31% mana | 2.9/5: 58% soul_shard lessons_of_spacetime, lord_of_flames
3:13.550 default S incinerate Fluffy_Pillow 352358.6/1100000: 32% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
3:14.557 default S incinerate Fluffy_Pillow 311578.3/1100000: 28% mana | 3.8/5: 76% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
3:15.563 default R immolate Fluffy_Pillow 270783.8/1100000: 25% mana | 4.1/5: 82% soul_shard lessons_of_spacetime, lord_of_flames
3:16.736 default S incinerate Fluffy_Pillow 221347.4/1100000: 20% mana | 4.3/5: 86% soul_shard lessons_of_spacetime, lord_of_flames
3:18.174 default P chaos_bolt Fluffy_Pillow 186653.1/1100000: 17% mana | 4.7/5: 94% soul_shard lord_of_flames
3:20.513 default H conflagrate Fluffy_Pillow 219721.5/1100000: 20% mana | 3.8/5: 76% soul_shard lord_of_flames, mark_of_the_claw
3:21.662 default S incinerate Fluffy_Pillow 236283.3/1100000: 21% mana | 4.3/5: 86% soul_shard backdraft(2), lord_of_flames, mark_of_the_claw
3:22.648 default P chaos_bolt Fluffy_Pillow 195495.6/1100000: 18% mana | 4.6/5: 92% soul_shard backdraft, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
3:24.254 default P chaos_bolt Fluffy_Pillow 218644.7/1100000: 20% mana | 2.8/5: 56% soul_shard lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
3:26.547 default F use_items Fluffy_Pillow 251646.3/1100000: 23% mana | 0.9/5: 18% soul_shard lord_of_flames, concordance_of_the_legionfall
3:26.547 default S incinerate Fluffy_Pillow 251646.3/1100000: 23% mana | 0.9/5: 18% soul_shard lord_of_flames, concordance_of_the_legionfall
3:27.985 default N dimensional_rift Fluffy_Pillow 216952.0/1100000: 20% mana | 1.4/5: 28% soul_shard lord_of_flames, concordance_of_the_legionfall
3:29.158 default H conflagrate Fluffy_Pillow 233515.7/1100000: 21% mana | 1.7/5: 34% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall
3:30.331 default M channel_demonfire Fluffy_Pillow 250079.3/1100000: 23% mana | 2.4/5: 48% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall
3:32.874 default R immolate Fluffy_Pillow 233188.5/1100000: 21% mana | 2.5/5: 50% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
3:34.047 default S incinerate Fluffy_Pillow 183753.6/1100000: 17% mana | 2.5/5: 50% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw
3:35.032 default S incinerate Fluffy_Pillow 142951.5/1100000: 13% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, mark_of_the_claw
3:36.018 default S incinerate Fluffy_Pillow 102163.8/1100000: 9% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
3:37.425 default H conflagrate Fluffy_Pillow 67444.5/1100000: 6% mana | 3.8/5: 76% soul_shard lord_of_flames, mark_of_the_claw
3:38.736 default S incinerate Fluffy_Pillow 86341.3/1100000: 8% mana | 4.3/5: 86% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
3:39.722 default P chaos_bolt Fluffy_Pillow 45553.7/1100000: 4% mana | 4.9/5: 98% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
3:41.328 default S incinerate Fluffy_Pillow 68702.7/1100000: 6% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
3:42.735 default T life_tap Fluffy_Pillow 33983.4/1100000: 3% mana | 3.3/5: 66% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
3:43.884 default S incinerate Fluffy_Pillow 380545.2/1100000: 35% mana | 3.5/5: 70% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
3:45.293 default C dimensional_rift Fluffy_Pillow 345854.6/1100000: 31% mana | 3.9/5: 78% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
3:46.441 default N dimensional_rift Fluffy_Pillow 362190.0/1100000: 33% mana | 4.3/5: 86% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
3:47.614 default P chaos_bolt Fluffy_Pillow 378753.6/1100000: 34% mana | 4.6/5: 92% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
3:49.954 default M channel_demonfire Fluffy_Pillow 411796.2/1100000: 37% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
3:52.506 default Q conflagrate Fluffy_Pillow 395032.4/1100000: 36% mana | 2.9/5: 58% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
3:53.679 default R immolate Fluffy_Pillow 411596.1/1100000: 37% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
3:54.852 default S incinerate Fluffy_Pillow 362161.2/1100000: 33% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw
3:55.838 default H conflagrate Fluffy_Pillow 321373.6/1100000: 29% mana | 3.9/5: 78% soul_shard backdraft, lord_of_flames, mark_of_the_claw
3:57.235 default S incinerate Fluffy_Pillow 341510.1/1100000: 31% mana | 4.4/5: 88% soul_shard backdraft(3), lord_of_flames, mark_of_the_claw
3:58.221 default P chaos_bolt Fluffy_Pillow 300722.4/1100000: 27% mana | 4.8/5: 96% soul_shard backdraft(2), lord_of_flames, mark_of_the_claw
3:59.827 default S incinerate Fluffy_Pillow 323871.4/1100000: 29% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, mark_of_the_claw
4:00.812 default S incinerate Fluffy_Pillow 283069.3/1100000: 26% mana | 3.3/5: 66% soul_shard lord_of_flames, mark_of_the_claw
4:02.221 default S incinerate Fluffy_Pillow 247975.8/1100000: 23% mana | 3.7/5: 74% soul_shard lord_of_flames
4:03.658 default F use_items Fluffy_Pillow 213267.3/1100000: 19% mana | 4.1/5: 82% soul_shard lord_of_flames
4:03.658 default S incinerate Fluffy_Pillow 213267.3/1100000: 19% mana | 4.1/5: 82% soul_shard lord_of_flames
4:05.094 default H conflagrate Fluffy_Pillow 178544.7/1100000: 16% mana | 4.5/5: 90% soul_shard lord_of_flames
4:06.506 default J dimensional_rift Fluffy_Pillow 198483.3/1100000: 18% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames
4:07.679 default L soul_harvest Fluffy_Pillow 215046.9/1100000: 20% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
4:07.679 default P chaos_bolt Fluffy_Pillow 215046.9/1100000: 20% mana | 5.0/5: 100% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames
4:09.319 default M channel_demonfire Fluffy_Pillow 238309.4/1100000: 22% mana | 4.0/5: 80% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, mark_of_the_claw
4:11.841 default D immolate Fluffy_Pillow 221861.8/1100000: 20% mana | 4.1/5: 82% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, mark_of_the_claw
4:12.989 default P chaos_bolt Fluffy_Pillow 172409.2/1100000: 16% mana | 4.1/5: 82% soul_shard soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, mark_of_the_claw
4:14.595 default H conflagrate Fluffy_Pillow 195558.3/1100000: 18% mana | 3.2/5: 64% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, mark_of_the_claw
4:15.745 default P chaos_bolt Fluffy_Pillow 211905.1/1100000: 19% mana | 3.7/5: 74% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos
4:17.384 default S incinerate Fluffy_Pillow 235049.0/1100000: 21% mana | 1.8/5: 36% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos
4:18.391 default P chaos_bolt Fluffy_Pillow 194268.7/1100000: 18% mana | 2.2/5: 44% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:20.730 default N dimensional_rift Fluffy_Pillow 227297.2/1100000: 21% mana | 0.3/5: 6% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:21.903 default S incinerate Fluffy_Pillow 243860.8/1100000: 22% mana | 0.6/5: 12% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
4:23.341 default S incinerate Fluffy_Pillow 209166.5/1100000: 19% mana | 1.1/5: 22% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
4:24.778 default Q conflagrate Fluffy_Pillow 174458.0/1100000: 16% mana | 1.4/5: 28% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
4:25.950 default S incinerate Fluffy_Pillow 191007.6/1100000: 17% mana | 2.0/5: 40% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
4:26.958 default F use_items Fluffy_Pillow 150241.3/1100000: 14% mana | 2.3/5: 46% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
4:26.958 default R immolate Fluffy_Pillow 150241.3/1100000: 14% mana | 2.3/5: 46% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
4:28.129 default S incinerate Fluffy_Pillow 100776.8/1100000: 9% mana | 2.4/5: 48% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
4:29.137 default M channel_demonfire Fluffy_Pillow 60010.5/1100000: 5% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall
4:31.812 default N dimensional_rift Fluffy_Pillow 44983.6/1100000: 4% mana | 2.8/5: 56% soul_shard lord_of_flames, concordance_of_the_legionfall
4:32.986 default P chaos_bolt Fluffy_Pillow 61561.4/1100000: 6% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall
4:35.326 default H conflagrate Fluffy_Pillow 94604.0/1100000: 9% mana | 1.4/5: 28% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall
4:36.499 default S incinerate Fluffy_Pillow 111167.6/1100000: 10% mana | 1.9/5: 38% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:37.506 default S incinerate Fluffy_Pillow 70387.2/1100000: 6% mana | 2.3/5: 46% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:38.514 default T life_tap Fluffy_Pillow 29621.0/1100000: 3% mana | 2.6/5: 52% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:39.687 default S incinerate Fluffy_Pillow 376184.7/1100000: 34% mana | 2.7/5: 54% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
4:41.123 default S incinerate Fluffy_Pillow 341462.1/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
4:42.560 default Q conflagrate Fluffy_Pillow 306753.6/1100000: 28% mana | 4.4/5: 88% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
4:43.770 default P chaos_bolt Fluffy_Pillow 323839.8/1100000: 29% mana | 4.9/5: 98% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity
4:45.410 default O chaos_bolt Fluffy_Pillow 346997.8/1100000: 32% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
4:47.048 default R immolate Fluffy_Pillow 370127.7/1100000: 34% mana | 1.1/5: 22% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
4:48.218 default S incinerate Fluffy_Pillow 320649.0/1100000: 29% mana | 1.1/5: 22% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
4:49.655 default M channel_demonfire Fluffy_Pillow 285940.5/1100000: 26% mana | 1.5/5: 30% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
4:52.300 default Q conflagrate Fluffy_Pillow 270490.0/1100000: 25% mana | 1.6/5: 32% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:53.472 default O chaos_bolt Fluffy_Pillow 287039.5/1100000: 26% mana | 2.2/5: 44% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 75895 75895 46630
Intellect 61279 59573 49413 (4609)
Spirit 1 1 0
Health 4553700 4553700 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 61279 59573 0
Crit 23.42% 23.42% 7369
Haste 28.37% 27.37% 10264
Damage / Heal Versatility 8.10% 8.10% 3849
ManaReg per Second 14121 14011 0
Mastery 49.40% 49.40% 6681
Armor 2233 2233 2233
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 938.00
Local Head Diabolic Helm
ilevel: 930, stats: { 281 Armor, +4305 Sta, +2870 Int, +1082 Crit, +766 Mastery }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Lessons of Space-Time
ilevel: 970, stats: { 300 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Chest Diabolic Robe
ilevel: 930, stats: { 346 Armor, +4305 Sta, +2870 Int, +1241 Haste, +607 Vers }
Local Waist Feretory of Souls
ilevel: 970, stats: { 225 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Legs Diabolic Leggings
ilevel: 930, stats: { 303 Armor, +4305 Sta, +2870 Int, +1162 Mastery, +686 Haste }
Local Feet Slippers of Enduring Vigilance
ilevel: 930, stats: { 238 Armor, +3229 Sta, +2153 Int, +931 Haste, +455 Mastery }
Local Wrists Oathbreaker's Cuffs
ilevel: 930, stats: { 151 Armor, +2422 Sta, +1615 Int, +676 Crit, +364 Vers }
Local Hands Gloves of Furtive Oppression
ilevel: 930, stats: { 216 Armor, +3229 Sta, +2153 Int, +812 Crit, +574 Mastery }
Local Finger1 Yathae's Thumb Ring
ilevel: 930, stats: { +2422 Sta, +2414 Crit, +1106 Vers }, enchant: { +200 Haste }
Local Finger2 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Diabolic Shroud
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +676 Crit, +364 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 957, weapon: { 9093 - 13641, 3.6 }, stats: { +3691 Int, +5537 Sta, +1024 Haste, +1024 Mastery, +20134 Int }, relics: { +55 ilevels, +55 ilevels, +55 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="T20 2pc"
spec=destruction
level=110
race=troll
role=spell
position=back
talents=1203012
artifact=38:0:0:0:0:803:1:804:4:805:4:806:4:807:4:808:4:809:4:810:4:811:4:812:4:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1612:1:1713:1

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
actions+=/havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/cataclysm,if=spell_targets.cataclysm>=3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
actions+=/immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/use_items
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest,if=!buff.soul_harvest.remains
actions+=/chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
actions+=/rain_of_fire,if=active_enemies>=3
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=active_enemies<3&target.time_to_die<=10
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=diabolic_helm,id=147183,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant_id=5437
shoulders=lessons_of_spacetime,id=144369,ilevel=970
back=diabolic_shroud,id=147181,ilevel=930,enchant_id=5436
chest=diabolic_robe,id=147185,ilevel=930
wrists=oathbreakers_cuffs,id=147001,ilevel=930
hands=gloves_of_furtive_oppression,id=146988,ilevel=930
waist=feretory_of_souls,id=132456,ilevel=970
legs=diabolic_leggings,id=147184,ilevel=930
feet=slippers_of_enduring_vigilance,id=146987,ilevel=930
finger1=yathaes_thumb_ring,id=147021,ilevel=930,enchant_id=5428
finger2=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant_id=5428
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=scepter_of_sargeras,id=128941,ilevel=957,gem_id=147087/147090/147087

# Gear Summary
# gear_ilvl=938.47
# gear_stamina=46630
# gear_intellect=49413
# gear_crit_rating=7369
# gear_haste_rating=10264
# gear_mastery_rating=6681
# gear_versatility_rating=3849
# gear_armor=2233
# set_bonus=tier20_2pc=1
default_pet=imp

T20 4pc : 1347243 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1347243.3 1347243.3 1917.8 / 0.142% 183887.4 / 13.6% 44.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
23046.7 23046.7 Mana 0.00% 46.7 99.9% 100%
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Channel Demonfire (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T20 4pc 1347243
Channel Demonfire 0 (163775) 0.0% (12.2%) 16.0 19.10sec 3065222 1264874

Stats details: channel_demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.05 0.00 239.95 0.00 2.4234 0.1453 0.00 0.00 0.00 1264873.54 1264873.54
 
 

Action details: channel_demonfire

Static Values
  • id:196447
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:52800.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
Spelldata
  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Channel Demonfire (_tick) 163775 12.2% 0.0 0.00sec 0 0 Direct 236.8 166690 333201 207733 24.7%  

Stats details: channel_demonfire_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 236.77 0.00 0.00 0.0000 0.0000 49184607.42 49184607.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.41 75.35% 166690.48 120068 242680 166833.15 157705 181501 29738224 29738224 0.00
crit 58.36 24.65% 333200.56 240133 485356 333476.32 305973 359837 19446383 19446383 0.00
 
 

Action details: channel_demonfire_tick

Static Values
  • id:196448
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Chaos Bolt 387424 28.8% 41.3 7.18sec 2816431 1502116 Direct 42.2 0 2760378 2760378 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.33 42.16 0.00 0.00 1.8750 0.0000 116389927.78 116389927.78 0.00 1502115.63 1502115.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 42.16 100.00% 2760378.03 2187296 3764864 2761397.81 2642530 2891720 116389928 116389928 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=1}} Chaos damage. Damage is further increased by your critical strike chance.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 108688 8.1% 35.3 8.60sec 925831 845621 Direct 35.3 494359 1194502 925815 61.6%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.26 35.26 0.00 0.00 1.0949 0.0000 32642668.28 32642668.28 0.00 845621.17 845621.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.53 38.37% 494359.02 359061 725515 494667.43 432136 583039 6688368 6688368 0.00
crit 21.73 61.63% 1194501.72 718356 1825322 1195443.61 1044532 1332350 25954300 25954300 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 6568 0.5% 13.8 2.12sec 140188 0 Direct 13.8 112712 224800 140195 24.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.83 13.83 0.00 0.00 0.0000 0.0000 1939121.62 1939121.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.44 75.49% 112711.73 98855 130488 112696.71 98855 126139 1176862 1176862 0.00
crit 3.39 24.51% 224800.28 197709 260976 218703.36 0 260976 762260 762260 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 110142 8.2% 17.2 17.94sec 1929698 1726482 Direct 17.2 269125 537710 424751 57.9%  
Periodic 136.1 120533 240760 189714 57.5% 98.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.16 17.16 136.12 136.12 1.1178 2.1811 33112189.63 33112189.63 0.00 104761.54 1726481.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.22 42.05% 269125.03 198369 400821 269158.39 0 326034 1941949 1941949 0.00
crit 9.94 57.95% 537709.88 396635 801010 537852.67 463514 620522 5346806 5346806 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.8 42.46% 120532.62 150 179422 120627.68 113779 128783 6966756 6966756 0.00
crit 78.3 57.54% 240760.25 232 358831 240929.45 227864 255426 18856679 18856679 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 165683 12.3% 90.2 3.24sec 552828 479411 Direct 89.8 441982 882059 555036 25.7%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.16 89.80 0.00 0.00 1.1531 0.0000 49840564.48 49840564.48 0.00 479411.37 479411.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.73 74.31% 441981.80 330251 667506 442322.93 423143 467318 29493489 29493489 0.00
crit 23.07 25.69% 882058.60 660551 1334803 882622.59 800597 973055 20347076 20347076 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:55000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.84
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Insidious Corruption 13586 1.0% 5.1 60.54sec 805265 0 Periodic 42.8 76951 154010 95552 24.1% 19.8%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.08 0.00 42.79 42.79 0.0000 1.3955 4088836.58 4088836.58 0.00 68466.79 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.5 75.87% 76951.36 1309 103505 76933.57 72424 83014 2498353 2498353 0.00
crit 10.3 24.13% 154010.47 2618 172508 153943.02 2618 172508 1590484 1590484 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Spectral Owl 0 (73563) 0.0% (5.4%) 3.0 120.46sec 7313109 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 0.00 57.37 0.00 0.0000 1.0000 0.00 0.00 0.00 383138.91 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 22747 1.7% 33.0 8.02sec 205822 0 Direct 32.8 166369 333297 207166 24.4%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.03 32.81 0.00 0.00 0.0000 0.0000 6797494.66 6797494.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.79 75.56% 166369.24 138719 183108 166404.63 155809 178749 4124880 4124880 0.00
crit 8.02 24.44% 333296.61 277437 366217 333358.78 277437 366217 2672614 2672614 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
    Spectral Bolt 50816 3.8% 85.7 3.04sec 177162 0 Direct 85.3 143144 286453 177903 24.3%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.70 85.34 0.00 0.00 0.0000 0.0000 15182801.65 15182801.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.64 75.74% 143143.67 118901 156949 143165.55 137323 151004 9252559 9252559 0.00
crit 20.70 24.26% 286452.72 237802 313898 286472.68 257301 307557 5930242 5930242 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90466.53
  • base_dd_max:99989.32
 
pet - infernal 108649 / 1165
Immolation 45721 0.0% 1.0 0.00sec 144767 0 Periodic 2.0 58265 116583 72378 24.2% 0.9%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 2.00 2.00 0.0000 1.3636 144767.19 144767.19 0.00 53086.61 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.5 75.79% 58264.75 57050 60799 54891.94 0 60799 88318 88318 0.00
crit 0.5 24.21% 116582.85 114100 121599 49691.21 0 121599 56450 56450 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 27524 0.0% 2.0 1.19sec 43591 31795 Direct 2.0 34892 69785 43587 24.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.3714 0.0000 87181.10 128164.47 31.98 31794.71 31794.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.50 75.07% 34891.83 34116 36358 32912.25 0 36358 52387 77014 30.16
crit 0.50 24.93% 69785.49 68232 72716 30836.86 0 72716 34794 51150 14.13
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Meteor Strike 35405 0.0% 1.0 0.00sec 112030 0 Direct 1.0 89603 179569 112040 24.9%  

Stats details: meteor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 112029.65 112029.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.75 75.07% 89602.74 87769 93537 67266.27 0 93537 67266 67266 0.00
crit 0.25 24.93% 179568.53 175538 187075 44763.38 0 187075 44763 44763 0.00
 
 

Action details: meteor_strike

Static Values
  • id:171018
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time>1
Spelldata
  • id:171018
  • name:Meteor Strike
  • school:fire
  • tooltip:Stunned.
  • description:The abyssal releases a powerful burst of flames, dealing {$s1=0} Fire damage to nearby targets, and stunning them for {$d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - doomguard 155485 / 153792
Doom Bolt 155485 11.4% 134.2 2.22sec 344635 155935 Direct 133.4 275964 550863 346581 25.7%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.20 133.44 0.00 0.00 2.2101 0.0000 46248834.64 46248834.64 0.00 155934.72 155934.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.15 74.31% 275963.73 240339 406790 276097.34 267081 287444 27362840 27362840 0.00
crit 34.28 25.69% 550862.75 480678 813580 551073.34 513064 597665 18885995 18885995 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 329882 / 27923
Immolation 206317 1.3% 3.0 0.00sec 1719380 0 Periodic 66.0 62926 125792 78153 24.2% 24.5%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 66.00 66.00 0.0000 1.1194 5158139.34 5158139.34 0.00 69819.69 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.0 75.78% 62926.16 51863 72959 62925.46 58521 68906 3147082 3147082 0.00
crit 16.0 24.22% 125791.63 103727 145918 125813.01 109951 143708 2011057 2011057 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 123564 0.8% 66.0 1.12sec 46807 41815 Direct 66.0 37688 75359 46806 24.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.00 66.00 0.00 0.00 1.1194 0.0000 3089235.13 4541468.25 31.98 41815.36 41815.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.02 75.79% 37687.51 31015 43630 37689.33 35222 40648 1885251 2771497 31.98
crit 15.98 24.21% 75359.09 62029 87260 75370.85 65130 85604 1203984 1769971 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 171673 / 25227
Shadow Bolt 171673 1.9% 3.5 68.95sec 2168808 0 Periodic 35.0 172663 344024 215931 25.3% 15.8%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.48 0.00 35.16 34.96 0.0000 1.3524 7548417.63 7548417.63 0.00 158736.94 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.1 74.74% 172662.88 805 224492 171982.89 0 221090 4511294 4511294 0.00
crit 8.8 25.26% 344023.69 2786 448983 339379.67 0 448983 3037123 3037123 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 238570 / 69151
Searing Bolt 238570 5.1% 69.0 2.66sec 297288 824217 Direct 68.6 90810 0 90810 0.0%  
Periodic 108.3 105276 209980 131955 25.5% 35.4%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.01 68.60 108.26 108.26 0.3607 0.9848 20515578.81 20515578.81 0.00 156000.14 824216.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.60 100.00% 90810.10 76514 112247 90764.62 0 112247 6230078 6230078 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.7 74.52% 105275.96 447 157176 104948.40 0 126869 8494172 8494172 0.00
crit 27.6 25.48% 209979.83 3214 314352 209279.08 0 302238 5791329 5791329 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=20 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.070000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 368193 / 20903
Chaos Bolt 368193 1.6% 3.5 69.84sec 1806697 811691 Direct 3.5 0 1815241 1815241 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.49 3.47 0.00 0.00 2.2259 0.0000 6297101.01 6297101.01 0.00 811691.29 811691.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.47 100.00% 1815240.82 1662034 2261471 1816737.99 0 2261471 6297101 6297101 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:8.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 373373 / 23064
Chaos Barrage 373373 1.7% 3.5 69.22sec 1965473 0 Periodic 109.8 49976 99477 62638 25.6% 6.3%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.50 0.00 110.31 109.84 0.0000 0.1730 6879959.24 6879959.24 0.00 360584.87 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.7 74.43% 49976.43 397 61736 49823.56 0 61736 4085506 4085506 0.00
crit 28.1 25.57% 99476.68 794 123473 99353.74 0 123473 2794453 2794453 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
T20 4pc
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T20 4pc
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.55sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 13.6 23.94sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.62 0.00 0.00 0.00 1.1165 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target. |cFFFFFFFFGenerates {$s2=3} Soul Shard Fragments.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T20 4pc
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T20 4pc
  • harmful:false
  • if_expr:
 
Life Tap 5.0 41.56sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.97 0.00 0.00 0.00 1.1567 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 3.0 121.52sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.soul_harvest.remains
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7764 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Backdraft 32.7 2.6 9.3sec 8.6sec 48.93% 41.94% 0.0(0.0) 2.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:16.03%
  • backdraft_2:30.15%
  • backdraft_3:1.12%
  • backdraft_4:1.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Berserking 2.1 0.0 180.5sec 180.5sec 6.89% 10.81% 0.0(0.0) 2.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 13.54% 0.0(0.0) 1.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.4 3.1 35.3sec 25.1sec 32.43% 32.43% 3.1(3.1) 8.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagration of Chaos 17.6 0.0 17.0sec 17.0sec 52.73% 48.30% 0.0(0.0) 0.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:52.73%

Trigger Attempt Success

  • trigger_pct:49.81%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a {$h=50}% chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Extracted Sanity 5.1 0.0 60.3sec 60.3sec 19.17% 19.17% 0.0(0.0) 4.7

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lessons of Space-Time 10.4 3.2 29.8sec 23.9sec 38.10% 38.10% 3.2(3.2) 10.1

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_lessons_of_spacetime
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • lessons_of_spacetime_1:38.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:236176
  • name:Lessons of Space-Time
  • tooltip:You and your minions deal {$s1=10}% increased damage.
  • description:{$@spelldesc236174=While you have a Dimensional Rift open, all of your damage is increased by {$236176s1=10}%.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 99.63% 99.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.1 4.2 22.9sec 17.1sec 30.13% 30.13% 4.2(4.2) 12.8

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.63% 19.63% 0.0(0.0) 1.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 3.0 0.0 121.5sec 121.5sec 13.39% 100.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • soul_harvest_1:13.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.4 69.3sec
flame_rift 3.4 69.5sec
chaos_tear 3.4 69.6sec
chaos_portal 3.4 69.6sec
dimension_ripper 4.5 51.3sec

Resources

Resource Usage Type Count Total Average RPE APR
T20 4pc
channel_demonfire Mana 28.1 1483388.1 52800.0 92445.9 33.2
chaos_bolt Soul Shard 74.1 148.2 2.0 3.6 785326.7
immolate Mana 30.0 1982863.5 66000.0 115556.4 16.7
incinerate Mana 157.9 8681802.0 55000.0 96297.9 5.7
summon_doomguard Soul Shard 1.8 1.8 1.0 1.8 0.0
pet - doomguard
doom_bolt Energy 134.3 4700.6 35.0 35.0 9838.9
pet - flame_rift
searing_bolt Energy 67.4 67.4 1.0 1.0 304289.7
Resource Gains Type Count Total Average Overflow
life_tap Mana 8.69 2868852.34 (26.99%) 330000.00 0.00 0.00%
immolate Soul Shard 238.33 22.54 (15.28%) 0.09 1.29 5.41%
dimensional_rift Soul Shard 23.86 6.77 (4.59%) 0.28 0.38 5.37%
conflagrate Soul Shard 61.73 30.16 (20.44%) 0.49 0.71 2.29%
incinerate Soul Shard 157.85 31.20 (21.14%) 0.20 0.37 1.17%
mp5_regen Mana 1316.14 7760388.60 (73.01%) 5896.32 118801.86 1.51%
immolate_crits Soul Shard 68.30 6.49 (4.40%) 0.09 0.34 5.02%
soulsnatcher Soul Shard 11.07 11.07 (7.50%) 1.00 0.00 0.00%
feretory_of_souls Soul Shard 21.04 19.80 (13.42%) 0.94 1.24 5.89%
incinerate_crits Soul Shard 40.56 3.99 (2.71%) 0.10 0.06 1.51%
destruction_t20_2pc Soul Shard 157.85 15.54 (10.53%) 0.10 0.25 1.56%
pet - doomguard
energy_regen Energy 234.96 8162.27 (100.00%) 34.74 272.49 3.23%
Resource RPS-Gain RPS-Loss
Health 0.00 7510.26
Mana 20165.19 23046.67
Soul Shard 0.28 0.28
Combat End Resource Mean Min Max
Mana 233467.59 7475.65 521330.05
Soul Shard 1.62 0.10 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.7%

Statistics & Data Analysis

Fight Length
Sample Data T20 4pc Fight Length
Count 2499
Mean 301.05
Minimum 213.79
Maximum 397.91
Spread ( max - min ) 184.12
Range [ ( max - min ) / 2 * 100% ] 30.58%
Standard Deviation 41.1144
5th Percentile 240.26
95th Percentile 367.03
( 95th Percentile - 5th Percentile ) 126.76
Mean Distribution
Standard Deviation 0.8225
95.00% Confidence Intervall ( 299.44 - 302.67 )
Normalized 95.00% Confidence Intervall ( 99.46% - 100.54% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 717
0.1% Error 71647
0.1 Scale Factor Error with Delta=300 15
0.05 Scale Factor Error with Delta=300 58
0.01 Scale Factor Error with Delta=300 1444
DPS
Sample Data T20 4pc Damage Per Second
Count 2499
Mean 1347243.29
Minimum 1155608.86
Maximum 1555111.03
Spread ( max - min ) 399502.17
Range [ ( max - min ) / 2 * 100% ] 14.83%
Standard Deviation 48914.6427
5th Percentile 1270734.31
95th Percentile 1425335.56
( 95th Percentile - 5th Percentile ) 154601.25
Mean Distribution
Standard Deviation 978.4886
95.00% Confidence Intervall ( 1345325.49 - 1349161.10 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5064
0.1 Scale Factor Error with Delta=300 20424971
0.05 Scale Factor Error with Delta=300 81699883
0.01 Scale Factor Error with Delta=300 2042497058
Priority Target DPS
Sample Data T20 4pc Priority Target Damage Per Second
Count 2499
Mean 1347243.29
Minimum 1155608.86
Maximum 1555111.03
Spread ( max - min ) 399502.17
Range [ ( max - min ) / 2 * 100% ] 14.83%
Standard Deviation 48914.6427
5th Percentile 1270734.31
95th Percentile 1425335.56
( 95th Percentile - 5th Percentile ) 154601.25
Mean Distribution
Standard Deviation 978.4886
95.00% Confidence Intervall ( 1345325.49 - 1349161.10 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5064
0.1 Scale Factor Error with Delta=300 20424971
0.05 Scale Factor Error with Delta=300 81699883
0.01 Scale Factor Error with Delta=300 2042497058
DPS(e)
Sample Data T20 4pc Damage Per Second (Effective)
Count 2499
Mean 1347243.29
Minimum 1155608.86
Maximum 1555111.03
Spread ( max - min ) 399502.17
Range [ ( max - min ) / 2 * 100% ] 14.83%
Damage
Sample Data T20 4pc Damage
Count 2499
Mean 309178212.10
Minimum 223969250.28
Maximum 387617352.79
Spread ( max - min ) 163648102.51
Range [ ( max - min ) / 2 * 100% ] 26.47%
DTPS
Sample Data T20 4pc Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T20 4pc Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T20 4pc Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T20 4pc Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T20 4pc Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T20 4pc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data T20 4pcTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T20 4pc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
0.00 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
C 1.12 dimensional_rift,if=charges=3
0.00 cataclysm,if=spell_targets.cataclysm>=3
D 6.20 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
0.00 immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
E 2.08 berserking
0.00 blood_fury
F 8.09 use_items
G 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
H 18.33 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
I 0.68 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
J 1.21 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
0.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
K 1.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
L 2.96 soul_harvest,if=!buff.soul_harvest.remains
0.00 chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
M 16.06 channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
0.00 rain_of_fire,if=active_enemies>=3
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
N 11.31 dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
O 1.87 chaos_bolt,if=active_enemies<3&target.time_to_die<=10
P 39.71 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
0.00 shadowburn
Q 16.28 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
R 11.03 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
S 90.53 incinerate
T 4.97 life_tap

Sample Sequence

0136ABCDEFHKLMNQSPHSNSPSSHPMDSSFHSSSSSSPQSMRSHPSSSSPHNSSMPDQSSSPHSSSSPMDQPSSSHFNPSSRPHMNPSSHPSTSRSHSSMSPHSPFSJLGPDHPSMSSHSTSRFSPPQSMSQPSRSSSHSSTSPMQSRSSNEPQSSSPSHMRSPSPQFSPSSTHSMRSSHPSSPNSQSRMPSQSSPFTLPHPRSMPQSSSSPFPQRNSMHPSSPSPHNRSSSMHSSTSSPPDPIHMNOSSO

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T20 4pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food T20 4pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_infernal Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation T20 4pc 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:00.000 default C dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:01.150 default D immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.3/5: 26% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.036 default E berserking Fluffy_Pillow 1034112.4/1100000: 94% mana | 1.3/5: 26% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.036 default F use_items Fluffy_Pillow 1034112.4/1100000: 94% mana | 1.3/5: 26% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.036 default H conflagrate Fluffy_Pillow 1034112.4/1100000: 94% mana | 1.3/5: 26% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.804 default K summon_doomguard Fluffy_Pillow 1050662.1/1100000: 96% mana | 1.8/5: 36% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.575 default L soul_harvest Fluffy_Pillow 1067276.5/1100000: 97% mana | 0.8/5: 16% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.575 default M channel_demonfire Fluffy_Pillow 1067276.5/1100000: 97% mana | 0.8/5: 16% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.366 default N dimensional_rift Fluffy_Pillow 1053070.9/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.136 default Q conflagrate Fluffy_Pillow 1069604.1/1100000: 97% mana | 1.3/5: 26% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.921 default S incinerate Fluffy_Pillow 1086175.8/1100000: 99% mana | 1.9/5: 38% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.675 default P chaos_bolt Fluffy_Pillow 1046773.3/1100000: 95% mana | 2.3/5: 46% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(3), lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.774 default H conflagrate Fluffy_Pillow 1069973.8/1100000: 97% mana | 0.4/5: 8% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.558 default S incinerate Fluffy_Pillow 1086524.5/1100000: 99% mana | 0.9/5: 18% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.312 default N dimensional_rift Fluffy_Pillow 1046773.3/1100000: 95% mana | 1.3/5: 26% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(3), lord_of_flames, potion_of_prolonged_power
0:11.098 default S incinerate Fluffy_Pillow 1063366.2/1100000: 97% mana | 1.6/5: 32% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(3), lord_of_flames, potion_of_prolonged_power
0:11.852 default P chaos_bolt Fluffy_Pillow 1024283.5/1100000: 93% mana | 2.2/5: 44% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:12.950 default S incinerate Fluffy_Pillow 1044946.2/1100000: 95% mana | 0.2/5: 4% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, potion_of_prolonged_power
0:13.727 default S incinerate Fluffy_Pillow 1004209.6/1100000: 91% mana | 0.6/5: 12% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, potion_of_prolonged_power
0:14.833 default H conflagrate Fluffy_Pillow 969512.4/1100000: 88% mana | 0.9/5: 18% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, potion_of_prolonged_power
0:15.737 default P chaos_bolt Fluffy_Pillow 986107.2/1100000: 90% mana | 2.6/5: 52% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:16.999 default M channel_demonfire Fluffy_Pillow 1009273.7/1100000: 92% mana | 0.7/5: 14% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, potion_of_prolonged_power
0:19.328 default D immolate Fluffy_Pillow 999227.2/1100000: 91% mana | 0.8/5: 16% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_prolonged_power
0:20.231 default S incinerate Fluffy_Pillow 949803.5/1100000: 86% mana | 0.9/5: 18% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_prolonged_power
0:21.007 default S incinerate Fluffy_Pillow 909048.6/1100000: 83% mana | 1.2/5: 24% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:22.114 default F use_items Fluffy_Pillow 874369.8/1100000: 79% mana | 1.7/5: 34% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:22.114 default H conflagrate Fluffy_Pillow 874369.8/1100000: 79% mana | 1.7/5: 34% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:23.016 default S incinerate Fluffy_Pillow 890927.8/1100000: 81% mana | 2.2/5: 44% soul_shard bloodlust, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:23.791 default S incinerate Fluffy_Pillow 850154.5/1100000: 77% mana | 2.5/5: 50% soul_shard bloodlust, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:24.566 default S incinerate Fluffy_Pillow 809382.7/1100000: 74% mana | 2.9/5: 58% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:25.651 default S incinerate Fluffy_Pillow 774713.8/1100000: 70% mana | 3.3/5: 66% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:26.737 default S incinerate Fluffy_Pillow 740063.6/1100000: 67% mana | 3.6/5: 72% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:27.821 default S incinerate Fluffy_Pillow 705376.0/1100000: 64% mana | 4.1/5: 82% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:28.906 default P chaos_bolt Fluffy_Pillow 670707.1/1100000: 61% mana | 4.5/5: 90% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:30.672 default Q conflagrate Fluffy_Pillow 703757.0/1100000: 64% mana | 2.6/5: 52% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:31.575 default S incinerate Fluffy_Pillow 720333.4/1100000: 65% mana | 3.3/5: 66% soul_shard bloodlust, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:32.350 default M channel_demonfire Fluffy_Pillow 679560.1/1100000: 62% mana | 3.6/5: 72% soul_shard bloodlust, backdraft, lord_of_flames, potion_of_prolonged_power
0:34.353 default R immolate Fluffy_Pillow 663529.2/1100000: 60% mana | 3.8/5: 76% soul_shard bloodlust, backdraft, lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:35.256 default S incinerate Fluffy_Pillow 614105.5/1100000: 56% mana | 4.0/5: 80% soul_shard bloodlust, backdraft, lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:36.032 default H conflagrate Fluffy_Pillow 573350.6/1100000: 52% mana | 4.4/5: 88% soul_shard bloodlust, lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:37.001 default P chaos_bolt Fluffy_Pillow 591138.5/1100000: 54% mana | 5.0/5: 100% soul_shard bloodlust, backdraft(2), lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:38.261 default S incinerate Fluffy_Pillow 614334.3/1100000: 56% mana | 3.0/5: 60% soul_shard bloodlust, backdraft, lord_of_flames, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.021 default S incinerate Fluffy_Pillow 573575.5/1100000: 52% mana | 3.4/5: 68% soul_shard bloodlust, lord_of_flames, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:40.106 default S incinerate Fluffy_Pillow 538906.6/1100000: 49% mana | 3.9/5: 78% soul_shard bloodlust, lord_of_flames, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.191 default S incinerate Fluffy_Pillow 499545.9/1100000: 45% mana | 4.2/5: 84% soul_shard lord_of_flames, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:42.600 default P chaos_bolt Fluffy_Pillow 464855.3/1100000: 42% mana | 5.0/5: 100% soul_shard lord_of_flames, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:44.893 default H conflagrate Fluffy_Pillow 497670.8/1100000: 45% mana | 3.0/5: 60% soul_shard lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:46.067 default N dimensional_rift Fluffy_Pillow 514248.5/1100000: 47% mana | 3.5/5: 70% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity, potion_of_prolonged_power
0:47.239 default S incinerate Fluffy_Pillow 530798.1/1100000: 48% mana | 3.9/5: 78% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:48.247 default S incinerate Fluffy_Pillow 490031.8/1100000: 45% mana | 4.3/5: 86% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:49.254 default M channel_demonfire Fluffy_Pillow 449251.4/1100000: 41% mana | 4.8/5: 96% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:51.829 default P chaos_bolt Fluffy_Pillow 432812.4/1100000: 39% mana | 4.9/5: 98% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:54.168 default D immolate Fluffy_Pillow 465840.9/1100000: 42% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:55.341 default Q conflagrate Fluffy_Pillow 416404.6/1100000: 38% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:56.513 default S incinerate Fluffy_Pillow 432954.1/1100000: 39% mana | 3.6/5: 72% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:57.521 default S incinerate Fluffy_Pillow 392187.9/1100000: 36% mana | 3.9/5: 78% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, potion_of_prolonged_power
0:58.528 default S incinerate Fluffy_Pillow 351407.5/1100000: 32% mana | 4.4/5: 88% soul_shard lessons_of_spacetime, lord_of_flames
0:59.965 default P chaos_bolt Fluffy_Pillow 316699.0/1100000: 29% mana | 4.7/5: 94% soul_shard lessons_of_spacetime, lord_of_flames
1:02.305 default H conflagrate Fluffy_Pillow 349742.8/1100000: 32% mana | 2.8/5: 56% soul_shard lord_of_flames, mark_of_the_claw
1:03.490 default S incinerate Fluffy_Pillow 366823.5/1100000: 33% mana | 3.4/5: 68% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:04.478 default S incinerate Fluffy_Pillow 326064.7/1100000: 30% mana | 3.7/5: 74% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:05.466 default S incinerate Fluffy_Pillow 285305.8/1100000: 26% mana | 4.1/5: 82% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:06.874 default S incinerate Fluffy_Pillow 250600.9/1100000: 23% mana | 4.5/5: 90% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:08.283 default P chaos_bolt Fluffy_Pillow 215910.4/1100000: 20% mana | 5.0/5: 100% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
1:10.577 default M channel_demonfire Fluffy_Pillow 248308.7/1100000: 23% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos
1:13.232 default D immolate Fluffy_Pillow 232999.3/1100000: 21% mana | 4.1/5: 82% soul_shard lord_of_flames, conflagration_of_chaos
1:14.405 default Q conflagrate Fluffy_Pillow 183563.0/1100000: 17% mana | 4.3/5: 86% soul_shard lord_of_flames, conflagration_of_chaos
1:15.578 default P chaos_bolt Fluffy_Pillow 200126.7/1100000: 18% mana | 4.8/5: 96% soul_shard backdraft(2), lord_of_flames
1:17.216 default S incinerate Fluffy_Pillow 223256.5/1100000: 20% mana | 2.9/5: 58% soul_shard backdraft, lord_of_flames
1:18.225 default S incinerate Fluffy_Pillow 182504.4/1100000: 17% mana | 3.3/5: 66% soul_shard lord_of_flames
1:19.663 default S incinerate Fluffy_Pillow 147810.0/1100000: 13% mana | 3.7/5: 74% soul_shard lord_of_flames
1:21.102 default H conflagrate Fluffy_Pillow 113131.6/1100000: 10% mana | 4.1/5: 82% soul_shard lord_of_flames, mark_of_the_claw
1:22.252 default F use_items Fluffy_Pillow 129707.8/1100000: 12% mana | 4.7/5: 94% soul_shard backdraft(2), lord_of_flames, mark_of_the_claw
1:22.252 default N dimensional_rift Fluffy_Pillow 129707.8/1100000: 12% mana | 4.7/5: 94% soul_shard backdraft(2), lord_of_flames, mark_of_the_claw
1:23.401 default P chaos_bolt Fluffy_Pillow 146269.6/1100000: 13% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw
1:25.008 default S incinerate Fluffy_Pillow 169433.1/1100000: 15% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, mark_of_the_claw
1:25.994 default S incinerate Fluffy_Pillow 128645.4/1100000: 12% mana | 3.4/5: 68% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
1:27.400 default R immolate Fluffy_Pillow 93822.5/1100000: 9% mana | 3.7/5: 74% soul_shard lessons_of_spacetime, lord_of_flames
1:28.572 default P chaos_bolt Fluffy_Pillow 44372.0/1100000: 4% mana | 3.8/5: 76% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall
1:30.913 default H conflagrate Fluffy_Pillow 77428.7/1100000: 7% mana | 1.9/5: 38% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall
1:32.087 default M channel_demonfire Fluffy_Pillow 94006.5/1100000: 9% mana | 2.4/5: 48% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall
1:34.699 default N dimensional_rift Fluffy_Pillow 78090.0/1100000: 7% mana | 2.5/5: 50% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity
1:35.872 default P chaos_bolt Fluffy_Pillow 94653.7/1100000: 9% mana | 2.9/5: 58% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity
1:37.512 default S incinerate Fluffy_Pillow 117811.7/1100000: 11% mana | 0.9/5: 18% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, concordance_of_the_legionfall, extracted_sanity
1:38.519 default S incinerate Fluffy_Pillow 77031.3/1100000: 7% mana | 1.5/5: 30% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, extracted_sanity
1:39.955 default H conflagrate Fluffy_Pillow 42308.8/1100000: 4% mana | 1.9/5: 38% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, extracted_sanity
1:41.126 default P chaos_bolt Fluffy_Pillow 58844.2/1100000: 5% mana | 2.4/5: 48% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity
1:42.765 default S incinerate Fluffy_Pillow 81988.1/1100000: 7% mana | 1.6/5: 32% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, concordance_of_the_legionfall, extracted_sanity
1:43.773 default T life_tap Fluffy_Pillow 41221.9/1100000: 4% mana | 2.0/5: 40% soul_shard lord_of_flames, concordance_of_the_legionfall, extracted_sanity
1:44.946 default S incinerate Fluffy_Pillow 387785.6/1100000: 35% mana | 2.1/5: 42% soul_shard lord_of_flames, concordance_of_the_legionfall, extracted_sanity
1:46.382 default R immolate Fluffy_Pillow 353063.0/1100000: 32% mana | 2.4/5: 48% soul_shard lord_of_flames
1:47.554 default S incinerate Fluffy_Pillow 303612.5/1100000: 28% mana | 2.5/5: 50% soul_shard lord_of_flames
1:48.992 default H conflagrate Fluffy_Pillow 268918.2/1100000: 24% mana | 2.8/5: 56% soul_shard lord_of_flames
1:50.189 default S incinerate Fluffy_Pillow 285820.8/1100000: 26% mana | 3.4/5: 68% soul_shard backdraft(2), lord_of_flames
1:51.197 default S incinerate Fluffy_Pillow 245054.5/1100000: 22% mana | 3.8/5: 76% soul_shard backdraft, lord_of_flames
1:52.203 default M channel_demonfire Fluffy_Pillow 204260.0/1100000: 19% mana | 4.2/5: 84% soul_shard lord_of_flames
1:54.825 default S incinerate Fluffy_Pillow 188484.7/1100000: 17% mana | 4.3/5: 86% soul_shard lord_of_flames
1:56.262 default P chaos_bolt Fluffy_Pillow 153776.2/1100000: 14% mana | 4.6/5: 92% soul_shard lord_of_flames
1:58.604 default H conflagrate Fluffy_Pillow 186847.1/1100000: 17% mana | 2.7/5: 54% soul_shard lord_of_flames
1:59.776 default S incinerate Fluffy_Pillow 203396.6/1100000: 18% mana | 4.3/5: 86% soul_shard backdraft(2), lord_of_flames
2:00.784 default P chaos_bolt Fluffy_Pillow 162630.4/1100000: 15% mana | 4.7/5: 94% soul_shard backdraft, lord_of_flames
2:02.423 default F use_items Fluffy_Pillow 185774.3/1100000: 17% mana | 2.8/5: 56% soul_shard lord_of_flames
2:02.423 default S incinerate Fluffy_Pillow 185774.3/1100000: 17% mana | 2.8/5: 56% soul_shard lord_of_flames
2:03.861 default J dimensional_rift Fluffy_Pillow 151080.0/1100000: 14% mana | 3.2/5: 64% soul_shard lord_of_flames
2:05.033 default L soul_harvest Fluffy_Pillow 167629.5/1100000: 15% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, lord_of_flames
2:05.033 default G potion Fluffy_Pillow 167629.5/1100000: 15% mana | 3.5/5: 70% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames
2:05.033 default P chaos_bolt Fluffy_Pillow 167629.5/1100000: 15% mana | 3.5/5: 70% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, potion_of_deadly_grace
2:07.374 default D immolate Fluffy_Pillow 201191.7/1100000: 18% mana | 1.7/5: 34% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, mark_of_the_claw, potion_of_deadly_grace
2:08.523 default H conflagrate Fluffy_Pillow 151753.5/1100000: 14% mana | 1.9/5: 38% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, mark_of_the_claw, potion_of_deadly_grace
2:09.671 default P chaos_bolt Fluffy_Pillow 168300.9/1100000: 15% mana | 2.4/5: 48% soul_shard soul_harvest, backdraft(2), lord_of_flames, mark_of_the_claw, potion_of_deadly_grace
2:11.276 default S incinerate Fluffy_Pillow 191435.5/1100000: 17% mana | 0.5/5: 10% soul_shard soul_harvest, backdraft, lord_of_flames, mark_of_the_claw, potion_of_deadly_grace
2:12.261 default M channel_demonfire Fluffy_Pillow 150454.5/1100000: 14% mana | 0.8/5: 16% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:14.882 default S incinerate Fluffy_Pillow 134665.0/1100000: 12% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:16.320 default S incinerate Fluffy_Pillow 99970.7/1100000: 9% mana | 1.4/5: 28% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:17.759 default H conflagrate Fluffy_Pillow 65290.5/1100000: 6% mana | 1.8/5: 36% soul_shard soul_harvest, lord_of_flames, potion_of_deadly_grace
2:18.933 default S incinerate Fluffy_Pillow 81868.3/1100000: 7% mana | 2.5/5: 50% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:19.940 default T life_tap Fluffy_Pillow 41087.9/1100000: 4% mana | 2.8/5: 56% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:21.112 default S incinerate Fluffy_Pillow 387637.4/1100000: 35% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:22.118 default R immolate Fluffy_Pillow 346842.9/1100000: 32% mana | 3.4/5: 68% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:23.290 default F use_items Fluffy_Pillow 297392.5/1100000: 27% mana | 3.6/5: 72% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:23.290 default S incinerate Fluffy_Pillow 297392.5/1100000: 27% mana | 3.6/5: 72% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:24.727 default P chaos_bolt Fluffy_Pillow 262684.0/1100000: 24% mana | 3.9/5: 78% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:27.067 default P chaos_bolt Fluffy_Pillow 295726.6/1100000: 27% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:29.408 default Q conflagrate Fluffy_Pillow 328783.4/1100000: 30% mana | 0.2/5: 4% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:30.583 default S incinerate Fluffy_Pillow 345375.3/1100000: 31% mana | 0.8/5: 16% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:31.591 default M channel_demonfire Fluffy_Pillow 304609.0/1100000: 28% mana | 1.1/5: 22% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:34.463 default S incinerate Fluffy_Pillow 292363.9/1100000: 27% mana | 1.3/5: 26% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_deadly_grace
2:35.470 default Q conflagrate Fluffy_Pillow 251583.5/1100000: 23% mana | 1.7/5: 34% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
2:36.801 default P chaos_bolt Fluffy_Pillow 270378.3/1100000: 25% mana | 2.3/5: 46% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity
2:38.440 default S incinerate Fluffy_Pillow 293522.2/1100000: 27% mana | 1.3/5: 26% soul_shard backdraft, lord_of_flames, concordance_of_the_legionfall, extracted_sanity
2:39.448 default R immolate Fluffy_Pillow 252755.9/1100000: 23% mana | 1.7/5: 34% soul_shard lord_of_flames, concordance_of_the_legionfall, extracted_sanity
2:40.620 default S incinerate Fluffy_Pillow 203305.5/1100000: 18% mana | 1.7/5: 34% soul_shard lord_of_flames, concordance_of_the_legionfall, extracted_sanity
2:42.057 default S incinerate Fluffy_Pillow 168597.0/1100000: 15% mana | 2.1/5: 42% soul_shard lord_of_flames, extracted_sanity
2:43.495 default S incinerate Fluffy_Pillow 133902.7/1100000: 12% mana | 2.6/5: 52% soul_shard lord_of_flames, extracted_sanity
2:44.931 default H conflagrate Fluffy_Pillow 99180.1/1100000: 9% mana | 2.9/5: 58% soul_shard lord_of_flames, extracted_sanity
2:46.148 default S incinerate Fluffy_Pillow 116365.1/1100000: 11% mana | 3.5/5: 70% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity
2:47.155 default S incinerate Fluffy_Pillow 75584.7/1100000: 7% mana | 3.8/5: 76% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
2:48.163 default T life_tap Fluffy_Pillow 34818.5/1100000: 3% mana | 4.3/5: 86% soul_shard lord_of_flames, conflagration_of_chaos
2:49.334 default S incinerate Fluffy_Pillow 381353.9/1100000: 35% mana | 4.3/5: 86% soul_shard lord_of_flames, conflagration_of_chaos
2:50.773 default P chaos_bolt Fluffy_Pillow 346762.0/1100000: 32% mana | 4.7/5: 94% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
2:53.066 default M channel_demonfire Fluffy_Pillow 379813.5/1100000: 35% mana | 2.8/5: 56% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
2:55.603 default Q conflagrate Fluffy_Pillow 363582.1/1100000: 33% mana | 2.9/5: 58% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
2:56.754 default S incinerate Fluffy_Pillow 380090.0/1100000: 35% mana | 3.4/5: 68% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
2:57.762 default R immolate Fluffy_Pillow 339323.8/1100000: 31% mana | 3.8/5: 76% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:58.934 default S incinerate Fluffy_Pillow 289873.3/1100000: 26% mana | 3.8/5: 76% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
2:59.940 default S incinerate Fluffy_Pillow 249078.8/1100000: 23% mana | 4.4/5: 88% soul_shard lord_of_flames, conflagration_of_chaos
3:01.379 default N dimensional_rift Fluffy_Pillow 214400.4/1100000: 19% mana | 4.7/5: 94% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:02.527 default E berserking Fluffy_Pillow 230947.8/1100000: 21% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:02.527 default P chaos_bolt Fluffy_Pillow 230947.8/1100000: 21% mana | 5.0/5: 100% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:04.522 default Q conflagrate Fluffy_Pillow 264017.3/1100000: 24% mana | 3.0/5: 60% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:05.522 default S incinerate Fluffy_Pillow 280593.6/1100000: 26% mana | 3.5/5: 70% soul_shard berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw
3:06.380 default S incinerate Fluffy_Pillow 239816.0/1100000: 22% mana | 4.0/5: 80% soul_shard berserking, lessons_of_spacetime, backdraft, lord_of_flames, mark_of_the_claw
3:07.238 default S incinerate Fluffy_Pillow 199038.4/1100000: 18% mana | 4.4/5: 88% soul_shard berserking, lessons_of_spacetime, lord_of_flames, mark_of_the_claw
3:08.461 default P chaos_bolt Fluffy_Pillow 163944.1/1100000: 15% mana | 5.0/5: 100% soul_shard berserking, lessons_of_spacetime, lord_of_flames
3:10.497 default S incinerate Fluffy_Pillow 197006.4/1100000: 18% mana | 3.0/5: 60% soul_shard berserking, lord_of_flames
3:11.747 default H conflagrate Fluffy_Pillow 162305.1/1100000: 15% mana | 3.3/5: 66% soul_shard berserking, lord_of_flames
3:12.767 default M channel_demonfire Fluffy_Pillow 178360.4/1100000: 16% mana | 3.9/5: 78% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:15.326 default R immolate Fluffy_Pillow 161695.4/1100000: 15% mana | 4.1/5: 82% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:16.499 default S incinerate Fluffy_Pillow 112259.1/1100000: 10% mana | 4.1/5: 82% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:17.508 default P chaos_bolt Fluffy_Pillow 71507.0/1100000: 7% mana | 4.6/5: 92% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:19.148 default S incinerate Fluffy_Pillow 94680.6/1100000: 9% mana | 2.7/5: 54% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:20.555 default P chaos_bolt Fluffy_Pillow 59961.2/1100000: 5% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:22.847 default Q conflagrate Fluffy_Pillow 92998.4/1100000: 8% mana | 1.2/5: 24% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:23.995 default F use_items Fluffy_Pillow 109545.7/1100000: 10% mana | 1.8/5: 36% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
3:23.995 default S incinerate Fluffy_Pillow 109545.7/1100000: 10% mana | 1.8/5: 36% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
3:24.980 default P chaos_bolt Fluffy_Pillow 68743.6/1100000: 6% mana | 2.1/5: 42% soul_shard backdraft, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
3:26.586 default S incinerate Fluffy_Pillow 91455.3/1100000: 8% mana | 0.2/5: 4% soul_shard lord_of_flames, concordance_of_the_legionfall
3:28.024 default S incinerate Fluffy_Pillow 56761.0/1100000: 5% mana | 0.5/5: 10% soul_shard lord_of_flames, concordance_of_the_legionfall
3:29.462 default T life_tap Fluffy_Pillow 22066.7/1100000: 2% mana | 1.9/5: 38% soul_shard lord_of_flames, concordance_of_the_legionfall
3:30.634 default H conflagrate Fluffy_Pillow 368616.2/1100000: 34% mana | 1.9/5: 38% soul_shard lord_of_flames
3:31.806 default S incinerate Fluffy_Pillow 385165.8/1100000: 35% mana | 2.5/5: 50% soul_shard backdraft(2), lord_of_flames
3:32.813 default M channel_demonfire Fluffy_Pillow 344385.4/1100000: 31% mana | 2.8/5: 56% soul_shard backdraft, lord_of_flames
3:35.343 default R immolate Fluffy_Pillow 327310.9/1100000: 30% mana | 2.9/5: 58% soul_shard backdraft, lord_of_flames
3:36.516 default S incinerate Fluffy_Pillow 277874.6/1100000: 25% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, extracted_sanity
3:37.525 default S incinerate Fluffy_Pillow 237122.5/1100000: 22% mana | 4.3/5: 86% soul_shard lord_of_flames, extracted_sanity
3:38.961 default H conflagrate Fluffy_Pillow 202399.9/1100000: 18% mana | 4.7/5: 94% soul_shard lord_of_flames, extracted_sanity
3:40.336 default P chaos_bolt Fluffy_Pillow 221816.0/1100000: 20% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity
3:41.976 default S incinerate Fluffy_Pillow 244974.0/1100000: 22% mana | 4.0/5: 80% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
3:42.983 default S incinerate Fluffy_Pillow 204193.7/1100000: 19% mana | 4.4/5: 88% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
3:44.421 default P chaos_bolt Fluffy_Pillow 169500.8/1100000: 15% mana | 4.7/5: 94% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
3:46.715 default N dimensional_rift Fluffy_Pillow 202566.8/1100000: 18% mana | 2.8/5: 56% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
3:47.864 default S incinerate Fluffy_Pillow 219128.6/1100000: 20% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
3:49.272 default Q conflagrate Fluffy_Pillow 184423.6/1100000: 17% mana | 3.6/5: 72% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:50.422 default S incinerate Fluffy_Pillow 200999.9/1100000: 18% mana | 4.2/5: 84% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:51.406 default R immolate Fluffy_Pillow 160183.3/1100000: 15% mana | 4.5/5: 90% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:52.554 default M channel_demonfire Fluffy_Pillow 110730.7/1100000: 10% mana | 4.6/5: 92% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:55.061 default P chaos_bolt Fluffy_Pillow 94066.9/1100000: 9% mana | 4.7/5: 94% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:56.667 default S incinerate Fluffy_Pillow 116805.6/1100000: 11% mana | 2.8/5: 56% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
3:58.103 default Q conflagrate Fluffy_Pillow 82083.0/1100000: 7% mana | 3.2/5: 64% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
3:59.274 default S incinerate Fluffy_Pillow 98618.4/1100000: 9% mana | 3.8/5: 76% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
4:00.282 default S incinerate Fluffy_Pillow 57852.2/1100000: 5% mana | 4.2/5: 84% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
4:01.289 default P chaos_bolt Fluffy_Pillow 17071.8/1100000: 2% mana | 4.7/5: 94% soul_shard lessons_of_spacetime, lord_of_flames
4:03.630 default F use_items Fluffy_Pillow 50128.5/1100000: 5% mana | 3.8/5: 76% soul_shard lord_of_flames
4:03.630 default T life_tap Fluffy_Pillow 50128.5/1100000: 5% mana | 3.8/5: 76% soul_shard lord_of_flames
4:04.801 default L soul_harvest Fluffy_Pillow 396663.9/1100000: 36% mana | 3.8/5: 76% soul_shard lord_of_flames
4:05.033 default P chaos_bolt Fluffy_Pillow 399940.0/1100000: 36% mana | 3.8/5: 76% soul_shard soul_harvest, lord_of_flames
4:07.372 default H conflagrate Fluffy_Pillow 432968.5/1100000: 39% mana | 1.9/5: 38% soul_shard soul_harvest, lord_of_flames
4:08.545 default P chaos_bolt Fluffy_Pillow 449532.1/1100000: 41% mana | 2.6/5: 52% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos
4:10.186 default R immolate Fluffy_Pillow 472704.3/1100000: 43% mana | 0.7/5: 14% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos
4:11.357 default S incinerate Fluffy_Pillow 423239.7/1100000: 38% mana | 0.7/5: 14% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos
4:12.364 default M channel_demonfire Fluffy_Pillow 382459.4/1100000: 35% mana | 1.0/5: 20% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:14.930 default P chaos_bolt Fluffy_Pillow 365893.3/1100000: 33% mana | 2.2/5: 44% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:17.270 default Q conflagrate Fluffy_Pillow 398935.9/1100000: 36% mana | 1.3/5: 26% soul_shard soul_harvest, lord_of_flames, conflagration_of_chaos
4:18.444 default S incinerate Fluffy_Pillow 415513.7/1100000: 38% mana | 1.8/5: 36% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos
4:19.451 default S incinerate Fluffy_Pillow 374733.3/1100000: 34% mana | 2.1/5: 42% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
4:20.458 default S incinerate Fluffy_Pillow 333952.9/1100000: 30% mana | 2.5/5: 50% soul_shard lord_of_flames, conflagration_of_chaos
4:21.895 default S incinerate Fluffy_Pillow 299261.2/1100000: 27% mana | 2.9/5: 58% soul_shard lord_of_flames, conflagration_of_chaos, mark_of_the_claw
4:23.303 default P chaos_bolt Fluffy_Pillow 264556.2/1100000: 24% mana | 4.2/5: 84% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:25.597 default F use_items Fluffy_Pillow 297622.2/1100000: 27% mana | 2.4/5: 48% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:25.597 default P chaos_bolt Fluffy_Pillow 297622.2/1100000: 27% mana | 2.4/5: 48% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:27.891 default Q conflagrate Fluffy_Pillow 330672.6/1100000: 30% mana | 0.6/5: 12% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:29.064 default R immolate Fluffy_Pillow 347236.3/1100000: 32% mana | 1.3/5: 26% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall
4:30.237 default N dimensional_rift Fluffy_Pillow 297799.9/1100000: 27% mana | 1.3/5: 26% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall
4:31.410 default S incinerate Fluffy_Pillow 314363.6/1100000: 29% mana | 1.7/5: 34% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall
4:32.419 default M channel_demonfire Fluffy_Pillow 273611.5/1100000: 25% mana | 2.1/5: 42% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, concordance_of_the_legionfall
4:35.048 default H conflagrate Fluffy_Pillow 257935.0/1100000: 23% mana | 2.2/5: 44% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, concordance_of_the_legionfall
4:36.219 default P chaos_bolt Fluffy_Pillow 274470.4/1100000: 25% mana | 2.8/5: 56% soul_shard lessons_of_spacetime, backdraft(3), lord_of_flames, concordance_of_the_legionfall
4:37.859 default S incinerate Fluffy_Pillow 297629.9/1100000: 27% mana | 1.8/5: 36% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:38.846 default S incinerate Fluffy_Pillow 256856.7/1100000: 23% mana | 3.4/5: 68% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, extracted_sanity, mark_of_the_claw
4:39.834 default P chaos_bolt Fluffy_Pillow 216097.8/1100000: 20% mana | 3.7/5: 74% soul_shard lord_of_flames, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:42.127 default S incinerate Fluffy_Pillow 249149.3/1100000: 23% mana | 1.8/5: 36% soul_shard lord_of_flames, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:43.535 default P chaos_bolt Fluffy_Pillow 214444.4/1100000: 19% mana | 2.3/5: 46% soul_shard lord_of_flames, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:45.829 default H conflagrate Fluffy_Pillow 246931.0/1100000: 22% mana | 0.4/5: 8% soul_shard lord_of_flames, concordance_of_the_legionfall, extracted_sanity
4:47.002 default N dimensional_rift Fluffy_Pillow 263494.7/1100000: 24% mana | 0.9/5: 18% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity
4:48.175 default R immolate Fluffy_Pillow 280058.4/1100000: 25% mana | 1.3/5: 26% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity
4:49.348 default S incinerate Fluffy_Pillow 230622.0/1100000: 21% mana | 1.3/5: 26% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall, extracted_sanity
4:50.355 default S incinerate Fluffy_Pillow 189841.7/1100000: 17% mana | 1.7/5: 34% soul_shard lessons_of_spacetime, backdraft, lord_of_flames
4:51.363 default S incinerate Fluffy_Pillow 149075.4/1100000: 14% mana | 2.1/5: 42% soul_shard lessons_of_spacetime, lord_of_flames
4:52.801 default M channel_demonfire Fluffy_Pillow 114381.1/1100000: 10% mana | 2.5/5: 50% soul_shard lessons_of_spacetime, lord_of_flames
4:55.376 default H conflagrate Fluffy_Pillow 97942.1/1100000: 9% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, lord_of_flames
4:56.548 default S incinerate Fluffy_Pillow 114491.6/1100000: 10% mana | 3.2/5: 64% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
4:57.555 default S incinerate Fluffy_Pillow 73711.2/1100000: 7% mana | 3.6/5: 72% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
4:58.563 default T life_tap Fluffy_Pillow 32945.0/1100000: 3% mana | 4.0/5: 80% soul_shard lord_of_flames, conflagration_of_chaos
4:59.736 default S incinerate Fluffy_Pillow 379508.6/1100000: 35% mana | 4.2/5: 84% soul_shard lord_of_flames, conflagration_of_chaos
5:01.171 default S incinerate Fluffy_Pillow 344771.9/1100000: 31% mana | 4.5/5: 90% soul_shard lord_of_flames, conflagration_of_chaos
5:02.608 default P chaos_bolt Fluffy_Pillow 310063.5/1100000: 28% mana | 4.9/5: 98% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
5:04.950 default P chaos_bolt Fluffy_Pillow 343134.3/1100000: 31% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
5:07.291 default D immolate Fluffy_Pillow 376191.1/1100000: 34% mana | 2.1/5: 42% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
5:08.465 default P chaos_bolt Fluffy_Pillow 326768.9/1100000: 30% mana | 2.3/5: 46% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
5:10.806 default I conflagrate Fluffy_Pillow 359827.1/1100000: 33% mana | 0.4/5: 8% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
5:11.954 default H conflagrate Fluffy_Pillow 376374.4/1100000: 34% mana | 1.1/5: 22% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
5:13.161 default M channel_demonfire Fluffy_Pillow 393772.3/1100000: 36% mana | 1.7/5: 34% soul_shard backdraft(4), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
5:15.739 default N dimensional_rift Fluffy_Pillow 378131.8/1100000: 34% mana | 1.8/5: 36% soul_shard backdraft(4), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
5:16.888 default O chaos_bolt Fluffy_Pillow 394668.1/1100000: 36% mana | 2.1/5: 42% soul_shard lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
5:18.526 default S incinerate Fluffy_Pillow 417798.0/1100000: 38% mana | 1.2/5: 24% soul_shard lessons_of_spacetime, backdraft(3), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
5:19.533 default S incinerate Fluffy_Pillow 377017.6/1100000: 34% mana | 1.6/5: 32% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
5:20.540 default O chaos_bolt Fluffy_Pillow 336237.2/1100000: 31% mana | 3.1/5: 62% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 75895 75895 46630
Intellect 61279 59573 49413 (4609)
Spirit 1 1 0
Health 4553700 4553700 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 61279 59573 0
Crit 23.42% 23.42% 7369
Haste 28.37% 27.37% 10264
Damage / Heal Versatility 8.10% 8.10% 3849
ManaReg per Second 14121 14011 0
Mastery 49.40% 49.40% 6681
Armor 2233 2233 2233
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 938.00
Local Head Diabolic Helm
ilevel: 930, stats: { 281 Armor, +4305 Sta, +2870 Int, +1082 Crit, +766 Mastery }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Lessons of Space-Time
ilevel: 970, stats: { 300 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Chest Diabolic Robe
ilevel: 930, stats: { 346 Armor, +4305 Sta, +2870 Int, +1241 Haste, +607 Vers }
Local Waist Feretory of Souls
ilevel: 970, stats: { 225 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Legs Diabolic Leggings
ilevel: 930, stats: { 303 Armor, +4305 Sta, +2870 Int, +1162 Mastery, +686 Haste }
Local Feet Slippers of Enduring Vigilance
ilevel: 930, stats: { 238 Armor, +3229 Sta, +2153 Int, +931 Haste, +455 Mastery }
Local Wrists Oathbreaker's Cuffs
ilevel: 930, stats: { 151 Armor, +2422 Sta, +1615 Int, +676 Crit, +364 Vers }
Local Hands Gloves of Furtive Oppression
ilevel: 930, stats: { 216 Armor, +3229 Sta, +2153 Int, +812 Crit, +574 Mastery }
Local Finger1 Yathae's Thumb Ring
ilevel: 930, stats: { +2422 Sta, +2414 Crit, +1106 Vers }, enchant: { +200 Haste }
Local Finger2 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Diabolic Shroud
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +676 Crit, +364 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 957, weapon: { 9093 - 13641, 3.6 }, stats: { +3691 Int, +5537 Sta, +1024 Haste, +1024 Mastery, +20134 Int }, relics: { +55 ilevels, +55 ilevels, +55 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="T20 4pc"
spec=destruction
level=110
race=troll
role=spell
position=back
talents=1203012
artifact=38:0:0:0:0:803:1:804:4:805:4:806:4:807:4:808:4:809:4:810:4:811:4:812:4:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1612:1:1713:1

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
actions+=/havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/cataclysm,if=spell_targets.cataclysm>=3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
actions+=/immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/use_items
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest,if=!buff.soul_harvest.remains
actions+=/chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
actions+=/rain_of_fire,if=active_enemies>=3
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=active_enemies<3&target.time_to_die<=10
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=diabolic_helm,id=147183,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant_id=5437
shoulders=lessons_of_spacetime,id=144369,ilevel=970
back=diabolic_shroud,id=147181,ilevel=930,enchant_id=5436
chest=diabolic_robe,id=147185,ilevel=930
wrists=oathbreakers_cuffs,id=147001,ilevel=930
hands=gloves_of_furtive_oppression,id=146988,ilevel=930
waist=feretory_of_souls,id=132456,ilevel=970
legs=diabolic_leggings,id=147184,ilevel=930
feet=slippers_of_enduring_vigilance,id=146987,ilevel=930
finger1=yathaes_thumb_ring,id=147021,ilevel=930,enchant_id=5428
finger2=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant_id=5428
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=scepter_of_sargeras,id=128941,ilevel=957,gem_id=147087/147090/147087

# Gear Summary
# gear_ilvl=938.47
# gear_stamina=46630
# gear_intellect=49413
# gear_crit_rating=7369
# gear_haste_rating=10264
# gear_mastery_rating=6681
# gear_versatility_rating=3849
# gear_armor=2233
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1
default_pet=imp

baseline : 1290685 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1290684.5 1290684.5 1930.5 / 0.150% 187668.2 / 14.5% 40.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
23932.2 23932.2 Mana 0.00% 47.1 100.1% 100%
Talents
  • 15: Backdraft (Destruction Warlock)
  • 30: Eradication (Destruction Warlock)
  • 60: Soul Harvest
  • 90: Grimoire of Supremacy
  • 100: Channel Demonfire (Destruction Warlock)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
baseline 1290685
Channel Demonfire 0 (162754) 0.0% (12.6%) 16.1 19.08sec 3039504 1254595

Stats details: channel_demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.10 0.00 240.57 0.00 2.4227 0.1453 0.00 0.00 0.00 1254595.40 1254595.40
 
 

Action details: channel_demonfire

Static Values
  • id:196447
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:52800.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
Spelldata
  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Channel Demonfire (_tick) 162754 12.6% 0.0 0.00sec 0 0 Direct 236.9 165658 331297 206497 24.7%  

Stats details: channel_demonfire_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 236.93 0.00 0.00 0.0000 0.0000 48924202.11 48924202.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.51 75.35% 165658.23 120065 242676 165818.15 155567 178696 29572208 29572208 0.00
crit 58.41 24.65% 331296.86 240132 485332 331641.43 306976 364817 19351995 19351995 0.00
 
 

Action details: channel_demonfire_tick

Static Values
  • id:196448
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Chaos Bolt 321405 24.9% 37.6 7.93sec 2571844 1376897 Direct 38.4 0 2516199 2516199 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.59 38.42 0.00 0.00 1.8679 0.0000 96669184.08 96669184.08 0.00 1376896.99 1376896.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 38.42 100.00% 2516199.33 1825716 3762710 2516897.45 2347797 2660296 96669184 96669184 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:116858
  • school:chromatic
  • resource:soul_shard
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=1}} Chaos damage. Damage is further increased by your critical strike chance.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:5.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Conflagrate 108296 8.4% 35.3 8.60sec 922690 842904 Direct 35.3 491997 1188890 922730 61.8%  

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.29 35.29 0.00 0.00 1.0947 0.0000 32558002.56 32558002.56 0.00 842903.81 842903.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.48 38.20% 491997.03 359065 725224 492421.13 427591 551306 6631874 6631874 0.00
crit 21.81 61.80% 1188889.67 718266 1827720 1189690.58 1046258 1349759 25926129 25926129 0.00
 
 

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:chi
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=1} Fire damage.{$?s196406=false}[ Reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.265510
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 6550 0.5% 13.8 2.12sec 140135 0 Direct 13.8 112686 225152 140135 24.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.82 13.82 0.00 0.00 0.0000 0.0000 1936631.91 1936631.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.45 75.59% 112685.92 98855 130488 112714.47 98855 126139 1177228 1177228 0.00
crit 3.37 24.41% 225151.94 197709 260976 220195.20 0 260976 759404 759404 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Immolate 109303 8.5% 17.2 17.95sec 1914107 1712366 Direct 17.2 267824 533591 420795 57.5%  
Periodic 136.2 119728 239130 188433 57.5% 98.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.19 17.19 136.20 136.20 1.1178 2.1828 32896264.59 32896264.59 0.00 103930.42 1712366.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.30 42.45% 267823.89 198331 400758 268025.44 217024 311920 1953981 1953981 0.00
crit 9.89 57.55% 533591.09 396642 801240 533959.78 470964 615567 5277588 5277588 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.8 42.46% 119728.14 296 179431 119817.02 110559 128575 6924499 6924499 0.00
crit 78.4 57.54% 239129.64 329 358866 239300.52 226656 254374 18740196 18740196 0.00
 
 

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:66000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.32
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=1} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.332000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.721500
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Incinerate 173697 13.5% 95.1 3.06sec 550134 475292 Direct 94.7 439076 875330 552282 26.0%  

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.08 94.71 0.00 0.00 1.1575 0.0000 52308781.60 52308781.60 0.00 475292.41 475292.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.13 74.04% 439075.88 330256 667429 439405.58 417250 468673 30790685 30790685 0.00
crit 24.58 25.96% 875329.91 660499 1334938 876011.70 805739 981094 21518096 21518096 0.00
 
 

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:55000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.84
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.331000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Insidious Corruption 13603 1.1% 5.1 60.53sec 807012 0 Periodic 42.8 77029 153865 95718 24.3% 19.8%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.08 0.00 42.82 42.82 0.0000 1.3955 4098405.50 4098405.50 0.00 68591.41 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.4 75.67% 77029.41 1309 103505 77018.53 72495 83456 2495812 2495812 0.00
crit 10.4 24.33% 153865.15 2618 188191 153795.57 108613 172508 1602593 1602593 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Spectral Owl 0 (73595) 0.0% (5.7%) 3.0 120.46sec 7304287 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 0.00 57.44 0.00 0.0000 1.0000 0.00 0.00 0.00 383297.98 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 22749 1.8% 33.1 8.08sec 205283 0 Direct 32.9 166513 332617 206628 24.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.14 32.93 0.00 0.00 0.0000 0.0000 6803838.06 6803838.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.98 75.85% 166513.12 138719 183108 166556.77 152736 179694 4158649 4158649 0.00
crit 7.95 24.15% 332617.48 277437 366217 332261.13 0 366217 2645189 2645189 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
    Spectral Bolt 50847 3.9% 85.8 3.05sec 177326 0 Direct 85.4 143208 286534 178070 24.3%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.80 85.44 0.00 0.00 0.0000 0.0000 15214331.38 15214331.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.65 75.67% 143207.77 118901 156949 143227.18 136548 149535 9258353 9258353 0.00
crit 20.79 24.33% 286534.25 237802 313898 286621.07 263584 313898 5955978 5955978 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90466.53
  • base_dd_max:99989.32
 
pet - infernal 108060 / 1161
Immolation 45545 0.0% 1.0 0.00sec 144611 0 Periodic 2.0 58284 116685 72312 24.0% 0.9%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 2.00 2.00 0.0000 1.3635 144611.00 144611.00 0.00 53029.34 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.5 75.99% 58283.56 57050 60799 54955.43 0 60799 88580 88580 0.00
crit 0.5 24.01% 116684.70 114100 121599 49346.78 0 121599 56031 56031 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 27418 0.0% 2.0 1.19sec 43562 31774 Direct 2.0 34917 69849 43559 24.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.3714 0.0000 87124.30 128080.98 31.98 31774.00 31774.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.51 75.25% 34917.40 34116 36358 32870.56 0 36358 52551 77255 30.11
crit 0.49 24.75% 69848.81 68232 72716 30476.30 0 72716 34574 50826 13.96
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Meteor Strike 35097 0.0% 1.0 0.00sec 111341 0 Direct 1.0 89695 179339 111353 24.1%  

Stats details: meteor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 111341.47 111341.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.76 75.85% 89694.86 87769 93537 68036.01 0 93537 68036 68036 0.00
crit 0.24 24.15% 179339.07 175538 187075 43305.46 0 187075 43305 43305 0.00
 
 

Action details: meteor_strike

Static Values
  • id:171018
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time>1
Spelldata
  • id:171018
  • name:Meteor Strike
  • school:fire
  • tooltip:Stunned.
  • description:The abyssal releases a powerful burst of flames, dealing {$s1=0} Fire damage to nearby targets, and stunning them for {$d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - doomguard 155677 / 153979
Doom Bolt 155677 12.0% 134.3 2.22sec 345110 156135 Direct 133.6 276255 551416 347058 25.7%  

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.34 133.59 0.00 0.00 2.2103 0.0000 46363534.43 46363534.43 0.00 156135.09 156135.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.22 74.27% 276254.65 240339 406790 276386.40 265151 287202 27409030 27409030 0.00
crit 34.37 25.73% 551415.67 480678 813580 551644.81 513008 595052 18954504 18954504 0.00
 
 

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage. Deals {$s2=20}% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - lord_of_flames_infernal 330173 / 27917
Immolation 206528 1.3% 3.0 0.00sec 1721132 0 Periodic 66.0 62945 125858 78234 24.3% 24.5%

Stats details: immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 66.00 66.00 0.0000 1.1194 5163396.91 5163396.91 0.00 69889.91 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.0 75.70% 62944.66 51863 72959 62943.38 58683 68706 3144815 3144815 0.00
crit 16.0 24.30% 125857.61 103727 145918 125862.54 111507 143708 2018582 2018582 0.00
 
 

Action details: immolation

Static Values
  • id:19483
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:19483
  • name:Immolation
  • school:fire
  • tooltip:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 seconds.
 

Action details: immolation_tick

Static Values
  • id:20153
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all enemies near the caster.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
melee 123645 0.8% 66.0 1.12sec 46837 41842 Direct 66.0 37696 75379 46836 24.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.00 66.00 0.00 0.00 1.1194 0.0000 3091251.99 4544433.23 31.98 41842.09 41842.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.99 75.74% 37695.53 31015 43630 37697.20 35119 40963 1884408 2770258 31.98
crit 16.01 24.26% 75378.90 62029 87260 75355.43 66371 85466 1206844 1774176 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - shadowy_tear 173736 / 25817
Shadow Bolt 173736 2.0% 3.6 68.02sec 2166873 0 Periodic 35.8 172345 344028 215642 25.2% 16.2%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 36.00 35.80 0.0000 1.3529 7720868.10 7720868.10 0.00 158536.13 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.8 74.77% 172345.45 1278 224492 171800.73 0 217689 4613737 4613737 0.00
crit 9.0 25.23% 344028.35 2555 448983 341208.04 0 448983 3107131 3107131 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:196657
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196657
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=1} Shadow damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - flame_rift 239568 / 71061
Searing Bolt 239568 5.4% 70.8 2.63sec 297993 825198 Direct 70.5 90864 0 90864 0.0%  
Periodic 111.5 105464 210016 131957 25.3% 36.4%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.84 70.46 111.46 111.46 0.3611 0.9848 21109384.09 21109384.09 0.00 155969.53 825197.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.46 100.00% 90864.33 76514 112247 90984.29 83400 112247 6402019 6402019 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.2 74.67% 105463.50 643 157176 105314.14 32411 130954 8776860 8776860 0.00
crit 28.2 25.33% 210016.46 12737 314352 209331.37 35357 274285 5930504 5930504 0.00
 
 

Action details: searing_bolt

Static Values
  • id:243050
  • school:fire
  • resource:energy
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243050
  • name:Searing Bolt
  • school:fire
  • tooltip:Burning for $w2 Fire damage every $t2 sec.
  • description:Sends a searing bolt at the enemy, causing {$s1=1} Fire damage, and an additional $o2 Fire damage over {$d=20 seconds}, stacking up to {$u=20} times.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.070000
  • base_td:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - chaos_tear 367978 / 21426
Chaos Bolt 367978 1.7% 3.6 68.01sec 1803732 811762 Direct 3.6 0 1814409 1814409 100.0%  

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 3.56 0.00 0.00 2.2222 0.0000 6457566.52 6457566.52 0.00 811761.98 811761.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 3.56 100.00% 1814408.66 1662034 2261471 1812340.09 0 2261471 6457567 6457567 0.00
 
 

Action details: chaos_bolt

Static Values
  • id:215279
  • school:chromatic
  • resource:none
  • range:100.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.500
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215279
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, causing {$s1=1} Chaos damage. Chaos Bolt always critically strikes and your critical strike chance increases its damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:8.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - chaos_portal 371275 / 23177
Chaos Barrage 371275 1.8% 3.6 66.58sec 1949915 0 Periodic 111.6 49907 99380 62487 25.4% 6.5%

Stats details: chaos_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 112.16 111.62 0.0000 0.1735 6974850.11 6974850.11 0.00 358364.60 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.2 74.57% 49906.60 244 61736 49780.57 0 61736 4154303 4154303 0.00
crit 28.4 25.43% 99379.57 794 123473 99280.74 0 123473 2820547 2820547 0.00
 
 

Action details: chaos_barrage

Static Values
  • id:187394
  • school:magic
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187394
  • name:Chaos Barrage
  • school:magic
  • tooltip:
  • description:Deals {$s1=1} Chaos damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.50
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
baseline
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.53sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dimensional Rift 14.0 23.22sec

Stats details: dimensional_rift

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.00 0.00 0.00 0.00 1.1163 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dimensional_rift

Static Values
  • id:196586
  • school:none
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:196586
  • name:Dimensional Rift
  • school:chaos
  • tooltip:
  • description:Rips a hole in time and space, opening a portal that damages your target. |cFFFFFFFFGenerates {$s2=3} Soul Shard Fragments.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Life Tap 5.8 37.59sec

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.79 0.00 0.00 0.00 1.1585 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:
  • description:Restores {$s1=30}% of your maximum mana, at the cost of {$s2=10}% of your maximum health.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Harvest 3.0 121.48sec

Stats details: soul_harvest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_harvest

Static Values
  • id:196098
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.soul_harvest.remains
Spelldata
  • id:196098
  • name:Soul Harvest
  • school:shadow
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
 
Summon Doomguard 1.0 0.00sec

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.7764 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:
  • description:Summons a Doomguard for {$60478d=25 seconds} to assault the target with its Doom Bolts.
 
Summon Infernal 1.0 0.00sec

Stats details: summon_infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_infernal

Static Values
  • id:1122
  • school:shadow
  • resource:soul_shard
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
Spelldata
  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemy targets in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=25 seconds}, dealing strong area-of-effect damage.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Backdraft 32.8 2.5 9.3sec 8.6sec 48.74% 41.67% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_backdraft
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • backdraft_1:15.95%
  • backdraft_2:30.16%
  • backdraft_3:1.03%
  • backdraft_4:1.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Casting Conflagrate reduces the cast time of your next two Incinerates or Chaos Bolts by {$117828s1=30}%.}
  • max_stacks:4
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Berserking 2.1 0.0 180.5sec 180.5sec 6.89% 10.80% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.4 3.2 35.2sec 24.6sec 32.82% 32.82% 3.2(3.2) 8.1

Buff details

  • buff initial source:baseline
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagration of Chaos 17.6 0.0 17.0sec 17.0sec 52.77% 48.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_conflagration_of_chaos
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-0.00

Stack Uptimes

  • conflagration_of_chaos_1:52.77%

Trigger Attempt Success

  • trigger_pct:50.03%

Spelldata details

  • id:196546
  • name:Conflagration of Chaos
  • tooltip:Your {$?s17877=false}[Shadowburn][Conflagrate] will always critically strike. Critical strike chance will increase the critical strike damage of {$?s17877=false}[Shadowburn][Conflagrate].
  • description:{$@spelldesc219195={$?s17877=false}[Shadowburn][Conflagrate] has a {$h=50}% chance to guarantee your next {$?s17877=false}[Shadowburn][Conflagrate] critically strikes, and to increase its damage by your critical strike chance.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Extracted Sanity 5.1 0.0 60.3sec 60.3sec 19.18% 19.18% 0.0(0.0) 4.7

Buff details

  • buff initial source:baseline
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lessons of Space-Time 10.6 3.4 29.3sec 23.3sec 38.83% 38.83% 3.4(3.4) 10.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lessons_of_spacetime
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • lessons_of_spacetime_1:38.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:236176
  • name:Lessons of Space-Time
  • tooltip:You and your minions deal {$s1=10}% increased damage.
  • description:{$@spelldesc236174=While you have a Dimensional Rift open, all of your damage is increased by {$236176s1=10}%.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Lord of Flames 1.0 0.0 0.0sec 0.0sec 99.63% 99.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lord_of_flames
  • max_stacks:1
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lord_of_flames_1:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:226802
  • name:Lord of Flames
  • tooltip:Recently activated Lord of Flames.
  • description:{$@spelldesc224103=Once every {$s2=10} minutes, {$?s152107=false}[your Infernal's Meteor Strike][Summon Infernal] will summon {$s3=3} additional Infernals to serve you for {$226804d=25 seconds}.}
  • max_stacks:0
  • duration:600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 13.1 4.1 22.9sec 17.1sec 30.10% 30.10% 4.1(4.1) 12.8

Buff details

  • buff initial source:baseline
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 1.0 0.0 0.0sec 0.0sec 10.14% 10.14% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Potion of Prolonged Power 1.0 0.0 0.0sec 0.0sec 19.61% 19.61% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:19.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Soul Harvest 3.0 0.0 121.5sec 121.5sec 13.41% 100.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:baseline
  • cooldown name:buff_soul_harvest
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • soul_harvest_1:13.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196098
  • name:Soul Harvest
  • tooltip:Damage increased by {$s1=20}%.
  • description:Increases your damage and your pets' damage by {$s1=20}%. Lasts {$d=12 seconds}, increased by {$s2=4} sec for each target afflicted by your {$?s137043=false}[Agony][]{$?s137044=false}[Doom][]{$?s137046=false}[Immolate][], up to a maximum of {$s3=36} sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:baseline
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
shadowy_tear 3.5 68.3sec
flame_rift 3.5 68.8sec
chaos_tear 3.5 67.5sec
chaos_portal 3.5 66.8sec
dimension_ripper 4.8 49.0sec

Resources

Resource Usage Type Count Total Average RPE APR
baseline
channel_demonfire Mana 28.7 1514377.8 52800.0 94083.4 32.3
chaos_bolt Soul Shard 68.8 137.5 2.0 3.7 702977.6
immolate Mana 30.6 2021161.8 66000.0 117603.6 16.3
incinerate Mana 169.4 9318599.4 55000.0 98004.2 5.6
summon_doomguard Soul Shard 1.8 1.8 1.0 1.8 0.0
pet - doomguard
doom_bolt Energy 134.3 4702.0 35.0 35.0 9860.3
pet - flame_rift
searing_bolt Energy 69.5 69.5 1.0 1.0 303886.1
Resource Gains Type Count Total Average Overflow
life_tap Mana 10.32 3407020.67 (30.11%) 330000.00 0.00 0.00%
immolate Soul Shard 242.70 23.27 (17.02%) 0.10 1.00 4.13%
dimensional_rift Soul Shard 24.94 7.20 (5.27%) 0.29 0.28 3.78%
conflagrate Soul Shard 62.88 30.94 (22.63%) 0.49 0.50 1.59%
incinerate Soul Shard 169.43 33.53 (24.52%) 0.20 0.35 1.05%
mp5_regen Mana 1347.33 7907079.45 (69.89%) 5868.72 121028.66 1.51%
immolate_crits Soul Shard 69.92 6.72 (4.92%) 0.10 0.27 3.83%
soulsnatcher Soul Shard 10.21 10.21 (7.46%) 1.00 0.00 0.00%
feretory_of_souls Soul Shard 21.62 20.52 (15.01%) 0.95 1.09 5.06%
incinerate_crits Soul Shard 43.96 4.34 (3.17%) 0.10 0.06 1.27%
pet - doomguard
energy_regen Energy 239.39 8316.09 (100.00%) 34.74 277.66 3.23%
Resource RPS-Gain RPS-Loss
Health 0.00 8752.76
Mana 21064.70 23932.22
Soul Shard 0.25 0.26
Combat End Resource Mean Min Max
Mana 235338.07 13019.26 494183.64
Soul Shard 1.56 0.10 4.20

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.7%

Statistics & Data Analysis

Fight Length
Sample Data baseline Fight Length
Count 2497
Mean 301.42
Minimum 209.85
Maximum 403.98
Spread ( max - min ) 194.13
Range [ ( max - min ) / 2 * 100% ] 32.20%
Standard Deviation 41.2122
5th Percentile 239.47
95th Percentile 367.27
( 95th Percentile - 5th Percentile ) 127.80
Mean Distribution
Standard Deviation 0.8247
95.00% Confidence Intervall ( 299.81 - 303.04 )
Normalized 95.00% Confidence Intervall ( 99.46% - 100.54% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 719
0.1% Error 71811
0.1 Scale Factor Error with Delta=300 15
0.05 Scale Factor Error with Delta=300 58
0.01 Scale Factor Error with Delta=300 1450
DPS
Sample Data baseline Damage Per Second
Count 2497
Mean 1290684.54
Minimum 1064860.19
Maximum 1489961.29
Spread ( max - min ) 425101.10
Range [ ( max - min ) / 2 * 100% ] 16.47%
Standard Deviation 49218.6162
5th Percentile 1214377.35
95th Percentile 1374406.81
( 95th Percentile - 5th Percentile ) 160029.46
Mean Distribution
Standard Deviation 984.9635
95.00% Confidence Intervall ( 1288754.05 - 1292615.03 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5587
0.1 Scale Factor Error with Delta=300 20679616
0.05 Scale Factor Error with Delta=300 82718464
0.01 Scale Factor Error with Delta=300 2067961588
Priority Target DPS
Sample Data baseline Priority Target Damage Per Second
Count 2497
Mean 1290684.54
Minimum 1064860.19
Maximum 1489961.29
Spread ( max - min ) 425101.10
Range [ ( max - min ) / 2 * 100% ] 16.47%
Standard Deviation 49218.6162
5th Percentile 1214377.35
95th Percentile 1374406.81
( 95th Percentile - 5th Percentile ) 160029.46
Mean Distribution
Standard Deviation 984.9635
95.00% Confidence Intervall ( 1288754.05 - 1292615.03 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5587
0.1 Scale Factor Error with Delta=300 20679616
0.05 Scale Factor Error with Delta=300 82718464
0.01 Scale Factor Error with Delta=300 2067961588
DPS(e)
Sample Data baseline Damage Per Second (Effective)
Count 2497
Mean 1290684.54
Minimum 1064860.19
Maximum 1489961.29
Spread ( max - min ) 425101.10
Range [ ( max - min ) / 2 * 100% ] 16.47%
Damage
Sample Data baseline Damage
Count 2497
Mean 291409641.79
Minimum 216121274.95
Maximum 361814181.99
Spread ( max - min ) 145692907.04
Range [ ( max - min ) / 2 * 100% ] 25.00%
DTPS
Sample Data baseline Damage Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data baseline Healing Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data baseline Healing Per Second (Effective)
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data baseline Heal
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data baseline Healing Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data baseline Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data baselineTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data baseline Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
3 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
4 0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
5 0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
6 0.00 augmentation,type=defiled
7 0.00 snapshot_stats
8 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
9 0.00 life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
A 0.00 potion,name=prolonged_power
B 0.00 chaos_bolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
0.00 havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
C 1.12 dimensional_rift,if=charges=3
0.00 cataclysm,if=spell_targets.cataclysm>=3
D 5.89 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
0.00 immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
0.00 immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
E 2.08 berserking
0.00 blood_fury
F 8.09 use_items
G 1.00 potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
0.00 shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
0.00 shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
0.00 conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
H 18.25 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
I 0.64 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
J 1.20 dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
0.00 service_pet
0.00 summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
0.00 summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
0.00 summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
K 1.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
0.00 summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
0.00 summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
L 2.96 soul_harvest,if=!buff.soul_harvest.remains
0.00 chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
M 16.10 channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
0.00 rain_of_fire,if=active_enemies>=3
0.00 rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
N 11.68 dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
0.00 life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
0.00 cataclysm
O 1.77 chaos_bolt,if=active_enemies<3&target.time_to_die<=10
P 36.01 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
0.00 chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
0.00 shadowburn
Q 16.39 conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
R 11.37 immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
S 95.40 incinerate
T 5.79 life_tap

Sample Sequence

0136ABCDEFHKLMNQPSQPSSSSPHRMSSSFQSPSSSPHSPMRHSSNSPSHNSSSMPDQSSSPPQSSSMDHPSPSHFSSSPRMHNSSSTSHPPRSSMQPSSSSHSSFSJLGPDHMPSNSHSTSPFRSQPMSSSQSPRSSSHPPMSTQPRSSNESQPSNMSQSSSRSSTHPFSSSMHSNPRSSQSSPSNMQPRPSSQPSFNSLTSHMPDSSHSPSSSFSQRMNSTSQPSSSNPPDMISNQSSSSSSOODMI

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask baseline 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food baseline 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_infernal Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 augmentation baseline 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat A potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/5: 60% soul_shard potion_of_prolonged_power
0:00.000 precombat B chaos_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:00.000 default C dimensional_rift Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.0/5: 20% soul_shard concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:01.148 default D immolate Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.3/5: 26% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.033 default E berserking Fluffy_Pillow 1034093.7/1100000: 94% mana | 1.3/5: 26% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.033 default F use_items Fluffy_Pillow 1034093.7/1100000: 94% mana | 1.3/5: 26% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.033 default H conflagrate Fluffy_Pillow 1034093.7/1100000: 94% mana | 1.3/5: 26% soul_shard bloodlust, berserking, lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.802 default K summon_doomguard Fluffy_Pillow 1050664.9/1100000: 96% mana | 1.8/5: 36% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.571 default L soul_harvest Fluffy_Pillow 1067236.2/1100000: 97% mana | 0.8/5: 16% soul_shard bloodlust, berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.571 default M channel_demonfire Fluffy_Pillow 1067236.2/1100000: 97% mana | 0.8/5: 16% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.351 default N dimensional_rift Fluffy_Pillow 1052793.6/1100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.120 default Q conflagrate Fluffy_Pillow 1069312.2/1100000: 97% mana | 1.3/5: 26% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.905 default P chaos_bolt Fluffy_Pillow 1085884.0/1100000: 99% mana | 2.9/5: 58% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.003 default S incinerate Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.9/5: 18% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(3), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.756 default Q conflagrate Fluffy_Pillow 1046752.2/1100000: 95% mana | 1.2/5: 24% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.542 default P chaos_bolt Fluffy_Pillow 1063345.1/1100000: 97% mana | 2.7/5: 54% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(4), lord_of_flames, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.641 default S incinerate Fluffy_Pillow 1086545.6/1100000: 99% mana | 0.8/5: 16% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(3), lord_of_flames, potion_of_prolonged_power
0:11.396 default S incinerate Fluffy_Pillow 1046794.4/1100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, berserking, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, potion_of_prolonged_power
0:12.149 default S incinerate Fluffy_Pillow 1007371.2/1100000: 92% mana | 1.3/5: 26% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft, lord_of_flames, potion_of_prolonged_power
0:12.923 default S incinerate Fluffy_Pillow 966579.6/1100000: 88% mana | 1.6/5: 32% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, potion_of_prolonged_power
0:14.030 default P chaos_bolt Fluffy_Pillow 931900.8/1100000: 85% mana | 2.1/5: 42% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, potion_of_prolonged_power
0:15.830 default H conflagrate Fluffy_Pillow 964943.4/1100000: 88% mana | 0.2/5: 4% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, lord_of_flames, potion_of_prolonged_power
0:16.733 default R immolate Fluffy_Pillow 981519.7/1100000: 89% mana | 0.9/5: 18% soul_shard bloodlust, soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:17.634 default M channel_demonfire Fluffy_Pillow 932059.4/1100000: 85% mana | 0.9/5: 18% soul_shard bloodlust, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:19.529 default S incinerate Fluffy_Pillow 914045.9/1100000: 83% mana | 1.0/5: 20% soul_shard bloodlust, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:20.305 default S incinerate Fluffy_Pillow 873296.3/1100000: 79% mana | 1.3/5: 26% soul_shard bloodlust, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:21.066 default S incinerate Fluffy_Pillow 832556.2/1100000: 76% mana | 2.6/5: 52% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:22.151 default F use_items Fluffy_Pillow 797887.3/1100000: 73% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:22.151 default Q conflagrate Fluffy_Pillow 797887.3/1100000: 73% mana | 3.0/5: 60% soul_shard bloodlust, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_prolonged_power
0:23.037 default S incinerate Fluffy_Pillow 814489.4/1100000: 74% mana | 3.5/5: 70% soul_shard bloodlust, backdraft(2), lord_of_flames, mark_of_the_claw, potion_of_prolonged_power
0:23.797 default P chaos_bolt Fluffy_Pillow 773730.6/1100000: 70% mana | 4.7/5: 94% soul_shard bloodlust, backdraft, lord_of_flames, mark_of_the_claw, potion_of_prolonged_power
0:25.032 default S incinerate Fluffy_Pillow 796872.4/1100000: 72% mana | 3.8/5: 76% soul_shard bloodlust, lord_of_flames, mark_of_the_claw, potion_of_prolonged_power
0:26.118 default S incinerate Fluffy_Pillow 762222.3/1100000: 69% mana | 4.1/5: 82% soul_shard bloodlust, lord_of_flames, mark_of_the_claw, potion_of_prolonged_power
0:27.202 default S incinerate Fluffy_Pillow 727187.2/1100000: 66% mana | 4.3/5: 86% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:28.307 default P chaos_bolt Fluffy_Pillow 692471.7/1100000: 63% mana | 4.7/5: 94% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:30.110 default H conflagrate Fluffy_Pillow 725569.4/1100000: 66% mana | 2.8/5: 56% soul_shard bloodlust, lord_of_flames, potion_of_prolonged_power
0:31.012 default S incinerate Fluffy_Pillow 742145.3/1100000: 67% mana | 3.4/5: 68% soul_shard bloodlust, backdraft(2), lord_of_flames, mark_of_the_claw, potion_of_prolonged_power
0:31.771 default P chaos_bolt Fluffy_Pillow 701367.7/1100000: 64% mana | 4.7/5: 94% soul_shard bloodlust, backdraft, lord_of_flames, mark_of_the_claw, potion_of_prolonged_power
0:33.008 default M channel_demonfire Fluffy_Pillow 724547.1/1100000: 66% mana | 2.8/5: 56% soul_shard bloodlust, lord_of_flames, mark_of_the_claw, potion_of_prolonged_power
0:35.073 default R immolate Fluffy_Pillow 710441.7/1100000: 65% mana | 2.9/5: 58% soul_shard bloodlust, lord_of_flames, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.957 default H conflagrate Fluffy_Pillow 661006.4/1100000: 60% mana | 2.9/5: 58% soul_shard bloodlust, lord_of_flames, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.988 default S incinerate Fluffy_Pillow 680316.9/1100000: 62% mana | 3.5/5: 70% soul_shard bloodlust, backdraft(2), lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:37.764 default S incinerate Fluffy_Pillow 639561.9/1100000: 58% mana | 3.7/5: 74% soul_shard bloodlust, backdraft, lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:38.539 default N dimensional_rift Fluffy_Pillow 598788.6/1100000: 54% mana | 4.0/5: 80% soul_shard bloodlust, lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:39.442 default S incinerate Fluffy_Pillow 615365.0/1100000: 56% mana | 4.3/5: 86% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:40.550 default P chaos_bolt Fluffy_Pillow 580704.5/1100000: 53% mana | 4.6/5: 92% soul_shard bloodlust, lessons_of_spacetime, lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:42.352 default S incinerate Fluffy_Pillow 606150.2/1100000: 55% mana | 2.7/5: 54% soul_shard lessons_of_spacetime, lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:43.791 default H conflagrate Fluffy_Pillow 571470.0/1100000: 52% mana | 2.9/5: 58% soul_shard lessons_of_spacetime, lord_of_flames, extracted_sanity, potion_of_prolonged_power
0:45.131 default N dimensional_rift Fluffy_Pillow 590391.8/1100000: 54% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity, potion_of_prolonged_power
0:46.303 default S incinerate Fluffy_Pillow 606941.4/1100000: 55% mana | 3.8/5: 76% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:47.309 default S incinerate Fluffy_Pillow 566146.8/1100000: 51% mana | 4.1/5: 82% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:48.316 default S incinerate Fluffy_Pillow 525366.5/1100000: 48% mana | 4.3/5: 86% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:49.753 default M channel_demonfire Fluffy_Pillow 490658.0/1100000: 45% mana | 4.6/5: 92% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:52.499 default P chaos_bolt Fluffy_Pillow 476633.7/1100000: 43% mana | 4.8/5: 96% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:54.838 default D immolate Fluffy_Pillow 509662.2/1100000: 46% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:56.009 default Q conflagrate Fluffy_Pillow 460197.6/1100000: 42% mana | 3.1/5: 62% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:57.182 default S incinerate Fluffy_Pillow 476761.2/1100000: 43% mana | 3.7/5: 74% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_prolonged_power
0:58.189 default S incinerate Fluffy_Pillow 435980.9/1100000: 40% mana | 3.9/5: 78% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
0:59.197 default S incinerate Fluffy_Pillow 395214.6/1100000: 36% mana | 4.2/5: 84% soul_shard lord_of_flames, conflagration_of_chaos
1:00.635 default P chaos_bolt Fluffy_Pillow 360520.3/1100000: 33% mana | 4.4/5: 88% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
1:02.975 default P chaos_bolt Fluffy_Pillow 393562.9/1100000: 36% mana | 2.5/5: 50% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
1:05.318 default Q conflagrate Fluffy_Pillow 426647.9/1100000: 39% mana | 0.6/5: 12% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
1:06.490 default S incinerate Fluffy_Pillow 443197.4/1100000: 40% mana | 1.2/5: 24% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall
1:07.496 default S incinerate Fluffy_Pillow 402402.9/1100000: 37% mana | 1.4/5: 28% soul_shard backdraft, lord_of_flames, concordance_of_the_legionfall
1:08.503 default S incinerate Fluffy_Pillow 361622.5/1100000: 33% mana | 1.7/5: 34% soul_shard lord_of_flames, concordance_of_the_legionfall
1:09.939 default M channel_demonfire Fluffy_Pillow 326900.0/1100000: 30% mana | 1.9/5: 38% soul_shard lord_of_flames, concordance_of_the_legionfall
1:12.397 default D immolate Fluffy_Pillow 308808.8/1100000: 28% mana | 2.2/5: 44% soul_shard lord_of_flames, concordance_of_the_legionfall
1:13.570 default H conflagrate Fluffy_Pillow 259372.5/1100000: 24% mana | 2.2/5: 44% soul_shard lord_of_flames, concordance_of_the_legionfall
1:14.743 default P chaos_bolt Fluffy_Pillow 275936.1/1100000: 25% mana | 2.9/5: 58% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall
1:16.383 default S incinerate Fluffy_Pillow 299099.8/1100000: 27% mana | 2.0/5: 40% soul_shard backdraft, lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
1:17.370 default P chaos_bolt Fluffy_Pillow 258326.5/1100000: 23% mana | 2.3/5: 46% soul_shard lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
1:19.664 default S incinerate Fluffy_Pillow 291392.5/1100000: 26% mana | 0.4/5: 8% soul_shard lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
1:21.072 default H conflagrate Fluffy_Pillow 256687.5/1100000: 23% mana | 0.8/5: 16% soul_shard lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
1:22.391 default F use_items Fluffy_Pillow 275691.8/1100000: 25% mana | 1.3/5: 26% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall
1:22.391 default S incinerate Fluffy_Pillow 275691.8/1100000: 25% mana | 1.3/5: 26% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall
1:23.397 default S incinerate Fluffy_Pillow 234897.3/1100000: 21% mana | 1.6/5: 32% soul_shard backdraft, lord_of_flames, concordance_of_the_legionfall
1:24.406 default S incinerate Fluffy_Pillow 194145.2/1100000: 18% mana | 1.8/5: 36% soul_shard lord_of_flames, concordance_of_the_legionfall
1:25.844 default P chaos_bolt Fluffy_Pillow 159450.8/1100000: 14% mana | 2.1/5: 42% soul_shard lord_of_flames, concordance_of_the_legionfall
1:28.182 default R immolate Fluffy_Pillow 192533.3/1100000: 18% mana | 1.2/5: 24% soul_shard lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
1:29.331 default M channel_demonfire Fluffy_Pillow 143095.1/1100000: 13% mana | 2.2/5: 44% soul_shard lord_of_flames, concordance_of_the_legionfall, mark_of_the_claw
1:31.885 default H conflagrate Fluffy_Pillow 127108.7/1100000: 12% mana | 2.4/5: 48% soul_shard lord_of_flames, mark_of_the_claw
1:33.034 default N dimensional_rift Fluffy_Pillow 143670.5/1100000: 13% mana | 3.0/5: 60% soul_shard backdraft(2), lord_of_flames, mark_of_the_claw
1:34.181 default S incinerate Fluffy_Pillow 160135.7/1100000: 15% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames
1:35.188 default S incinerate Fluffy_Pillow 119355.4/1100000: 11% mana | 3.6/5: 72% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, extracted_sanity
1:36.196 default S incinerate Fluffy_Pillow 78589.1/1100000: 7% mana | 3.9/5: 78% soul_shard lessons_of_spacetime, lord_of_flames, extracted_sanity
1:37.634 default T life_tap Fluffy_Pillow 43894.8/1100000: 4% mana | 4.2/5: 84% soul_shard lessons_of_spacetime, lord_of_flames, extracted_sanity
1:38.806 default S incinerate Fluffy_Pillow 390444.3/1100000: 35% mana | 4.2/5: 84% soul_shard lessons_of_spacetime, lord_of_flames, extracted_sanity
1:40.244 default H conflagrate Fluffy_Pillow 355750.0/1100000: 32% mana | 4.5/5: 90% soul_shard lessons_of_spacetime, lord_of_flames, extracted_sanity
1:41.417 default P chaos_bolt Fluffy_Pillow 372313.7/1100000: 34% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity
1:43.057 default P chaos_bolt Fluffy_Pillow 395471.7/1100000: 36% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
1:44.699 default R immolate Fluffy_Pillow 418658.0/1100000: 38% mana | 1.1/5: 22% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
1:45.872 default S incinerate Fluffy_Pillow 369221.7/1100000: 34% mana | 1.1/5: 22% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
1:47.309 default S incinerate Fluffy_Pillow 334513.2/1100000: 30% mana | 1.4/5: 28% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
1:48.746 default M channel_demonfire Fluffy_Pillow 299804.8/1100000: 27% mana | 1.6/5: 32% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
1:51.348 default Q conflagrate Fluffy_Pillow 283747.1/1100000: 26% mana | 1.8/5: 36% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
1:52.519 default P chaos_bolt Fluffy_Pillow 300282.5/1100000: 27% mana | 2.3/5: 46% soul_shard backdraft(2), lord_of_flames, concordance_of_the_legionfall
1:54.159 default S incinerate Fluffy_Pillow 323440.5/1100000: 29% mana | 0.4/5: 8% soul_shard backdraft, lord_of_flames, concordance_of_the_legionfall
1:55.167 default S incinerate Fluffy_Pillow 282674.3/1100000: 26% mana | 0.7/5: 14% soul_shard lord_of_flames
1:56.606 default S incinerate Fluffy_Pillow 247995.8/1100000: 23% mana | 1.1/5: 22% soul_shard lord_of_flames, mark_of_the_claw
1:58.014 default S incinerate Fluffy_Pillow 213290.9/1100000: 19% mana | 1.3/5: 26% soul_shard lord_of_flames, mark_of_the_claw
1:59.423 default H conflagrate Fluffy_Pillow 178600.4/1100000: 16% mana | 1.6/5: 32% soul_shard lord_of_flames, mark_of_the_claw
2:00.572 default S incinerate Fluffy_Pillow 195162.2/1100000: 18% mana | 2.2/5: 44% soul_shard backdraft(2), lord_of_flames, mark_of_the_claw
2:01.558 default S incinerate Fluffy_Pillow 154374.5/1100000: 14% mana | 2.4/5: 48% soul_shard backdraft, lord_of_flames, mark_of_the_claw
2:02.543 default F use_items Fluffy_Pillow 113572.4/1100000: 10% mana | 2.6/5: 52% soul_shard lord_of_flames, mark_of_the_claw
2:02.543 default S incinerate Fluffy_Pillow 113572.4/1100000: 10% mana | 2.6/5: 52% soul_shard lord_of_flames, mark_of_the_claw
2:03.950 default J dimensional_rift Fluffy_Pillow 78457.0/1100000: 7% mana | 3.0/5: 60% soul_shard lord_of_flames
2:05.123 default L soul_harvest Fluffy_Pillow 95020.7/1100000: 9% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, lord_of_flames
2:05.123 default G potion Fluffy_Pillow 95020.7/1100000: 9% mana | 3.3/5: 66% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames
2:05.123 default P chaos_bolt Fluffy_Pillow 95020.7/1100000: 9% mana | 3.3/5: 66% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, potion_of_deadly_grace
2:07.463 default D immolate Fluffy_Pillow 128063.3/1100000: 12% mana | 1.4/5: 28% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, potion_of_deadly_grace
2:08.635 default H conflagrate Fluffy_Pillow 78612.9/1100000: 7% mana | 1.7/5: 34% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, potion_of_deadly_grace
2:09.809 default M channel_demonfire Fluffy_Pillow 95190.6/1100000: 9% mana | 2.2/5: 44% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, potion_of_deadly_grace
2:12.483 default P chaos_bolt Fluffy_Pillow 80524.8/1100000: 7% mana | 2.3/5: 46% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw, potion_of_deadly_grace
2:14.089 default S incinerate Fluffy_Pillow 103673.8/1100000: 9% mana | 0.4/5: 8% soul_shard soul_harvest, backdraft, lord_of_flames, mark_of_the_claw, potion_of_deadly_grace
2:15.076 default N dimensional_rift Fluffy_Pillow 62900.5/1100000: 6% mana | 0.6/5: 12% soul_shard soul_harvest, lord_of_flames, mark_of_the_claw, potion_of_deadly_grace
2:16.224 default S incinerate Fluffy_Pillow 79447.9/1100000: 7% mana | 1.0/5: 20% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, mark_of_the_claw, potion_of_deadly_grace
2:17.632 default H conflagrate Fluffy_Pillow 44743.0/1100000: 4% mana | 2.2/5: 44% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, mark_of_the_claw, potion_of_deadly_grace
2:18.782 default S incinerate Fluffy_Pillow 61319.2/1100000: 6% mana | 3.9/5: 78% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_deadly_grace
2:19.768 default T life_tap Fluffy_Pillow 20531.5/1100000: 2% mana | 4.1/5: 82% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_deadly_grace
2:20.915 default S incinerate Fluffy_Pillow 367064.5/1100000: 33% mana | 4.2/5: 84% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_deadly_grace
2:21.902 default P chaos_bolt Fluffy_Pillow 326291.2/1100000: 30% mana | 4.5/5: 90% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw, potion_of_deadly_grace
2:24.196 default F use_items Fluffy_Pillow 359190.6/1100000: 33% mana | 3.6/5: 72% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:24.196 default R immolate Fluffy_Pillow 359190.6/1100000: 33% mana | 3.6/5: 72% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:25.367 default S incinerate Fluffy_Pillow 309726.0/1100000: 28% mana | 3.8/5: 76% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:26.805 default Q conflagrate Fluffy_Pillow 275031.7/1100000: 25% mana | 4.1/5: 82% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:27.976 default P chaos_bolt Fluffy_Pillow 291567.1/1100000: 27% mana | 4.6/5: 92% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:29.612 default M channel_demonfire Fluffy_Pillow 314668.7/1100000: 29% mana | 2.7/5: 54% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:32.128 default S incinerate Fluffy_Pillow 297396.6/1100000: 27% mana | 2.9/5: 58% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:33.137 default S incinerate Fluffy_Pillow 256644.4/1100000: 23% mana | 3.1/5: 62% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:34.574 default S incinerate Fluffy_Pillow 221936.0/1100000: 20% mana | 3.5/5: 70% soul_shard lord_of_flames, conflagration_of_chaos, potion_of_deadly_grace
2:36.011 default Q conflagrate Fluffy_Pillow 187227.5/1100000: 17% mana | 3.8/5: 76% soul_shard lord_of_flames, conflagration_of_chaos
2:37.184 default S incinerate Fluffy_Pillow 203791.2/1100000: 19% mana | 4.3/5: 86% soul_shard backdraft(2), lord_of_flames, extracted_sanity
2:38.190 default P chaos_bolt Fluffy_Pillow 162996.7/1100000: 15% mana | 4.5/5: 90% soul_shard backdraft, lord_of_flames, extracted_sanity
2:39.831 default R immolate Fluffy_Pillow 186168.9/1100000: 17% mana | 3.7/5: 74% soul_shard lord_of_flames, extracted_sanity
2:41.005 default S incinerate Fluffy_Pillow 136746.7/1100000: 12% mana | 3.8/5: 76% soul_shard lord_of_flames, extracted_sanity
2:42.443 default S incinerate Fluffy_Pillow 102053.8/1100000: 9% mana | 4.0/5: 80% soul_shard lord_of_flames, extracted_sanity, mark_of_the_claw
2:43.852 default S incinerate Fluffy_Pillow 67363.3/1100000: 6% mana | 4.3/5: 86% soul_shard lord_of_flames, extracted_sanity, mark_of_the_claw
2:45.259 default H conflagrate Fluffy_Pillow 32643.9/1100000: 3% mana | 4.5/5: 90% soul_shard lord_of_flames, extracted_sanity, mark_of_the_claw
2:46.407 default P chaos_bolt Fluffy_Pillow 49191.3/1100000: 4% mana | 5.0/5: 100% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity, mark_of_the_claw
2:48.013 default P chaos_bolt Fluffy_Pillow 72340.4/1100000: 7% mana | 3.0/5: 60% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:49.618 default M channel_demonfire Fluffy_Pillow 95128.9/1100000: 9% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
2:52.188 default S incinerate Fluffy_Pillow 78619.3/1100000: 7% mana | 1.3/5: 26% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
2:53.626 default T life_tap Fluffy_Pillow 43924.9/1100000: 4% mana | 1.5/5: 30% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
2:54.798 default Q conflagrate Fluffy_Pillow 390474.5/1100000: 35% mana | 1.6/5: 32% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
2:55.970 default P chaos_bolt Fluffy_Pillow 407024.0/1100000: 37% mana | 2.1/5: 42% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
2:57.609 default R immolate Fluffy_Pillow 430168.0/1100000: 39% mana | 0.3/5: 6% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
2:58.781 default S incinerate Fluffy_Pillow 380717.5/1100000: 35% mana | 0.3/5: 6% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
2:59.788 default S incinerate Fluffy_Pillow 339937.2/1100000: 31% mana | 0.6/5: 12% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:01.224 default N dimensional_rift Fluffy_Pillow 305214.6/1100000: 28% mana | 0.9/5: 18% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:02.395 default E berserking Fluffy_Pillow 321750.0/1100000: 29% mana | 1.3/5: 26% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:02.395 default S incinerate Fluffy_Pillow 321750.0/1100000: 29% mana | 1.3/5: 26% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:03.644 default Q conflagrate Fluffy_Pillow 287032.4/1100000: 26% mana | 1.6/5: 32% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:04.665 default P chaos_bolt Fluffy_Pillow 303612.3/1100000: 28% mana | 2.2/5: 44% soul_shard berserking, lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:06.089 default S incinerate Fluffy_Pillow 326736.5/1100000: 30% mana | 0.3/5: 6% soul_shard berserking, lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:06.965 default N dimensional_rift Fluffy_Pillow 285961.7/1100000: 26% mana | 0.5/5: 10% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:07.985 default M channel_demonfire Fluffy_Pillow 302544.0/1100000: 28% mana | 0.9/5: 18% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
3:10.422 default S incinerate Fluffy_Pillow 290140.2/1100000: 26% mana | 1.0/5: 20% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:11.648 default Q conflagrate Fluffy_Pillow 255462.7/1100000: 23% mana | 2.2/5: 44% soul_shard berserking, lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:12.648 default S incinerate Fluffy_Pillow 271491.9/1100000: 25% mana | 2.8/5: 56% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw
3:13.635 default S incinerate Fluffy_Pillow 230718.6/1100000: 21% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, mark_of_the_claw
3:14.621 default S incinerate Fluffy_Pillow 189728.2/1100000: 17% mana | 3.3/5: 66% soul_shard lessons_of_spacetime, lord_of_flames
3:16.059 default R immolate Fluffy_Pillow 155033.9/1100000: 14% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, lord_of_flames
3:17.231 default S incinerate Fluffy_Pillow 105584.6/1100000: 10% mana | 3.6/5: 72% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
3:18.640 default S incinerate Fluffy_Pillow 70894.1/1100000: 6% mana | 3.9/5: 78% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
3:20.048 default T life_tap Fluffy_Pillow 36189.1/1100000: 3% mana | 4.1/5: 82% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
3:21.197 default H conflagrate Fluffy_Pillow 382750.9/1100000: 35% mana | 4.2/5: 84% soul_shard lessons_of_spacetime, lord_of_flames, mark_of_the_claw
3:22.345 default P chaos_bolt Fluffy_Pillow 399298.3/1100000: 36% mana | 4.7/5: 94% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw
3:23.951 default F use_items Fluffy_Pillow 422235.0/1100000: 38% mana | 2.8/5: 56% soul_shard backdraft, lord_of_flames
3:23.951 default S incinerate Fluffy_Pillow 422235.0/1100000: 38% mana | 2.8/5: 56% soul_shard backdraft, lord_of_flames
3:24.960 default S incinerate Fluffy_Pillow 381482.9/1100000: 35% mana | 3.0/5: 60% soul_shard lord_of_flames
3:26.397 default S incinerate Fluffy_Pillow 346774.4/1100000: 32% mana | 3.4/5: 68% soul_shard lord_of_flames
3:27.835 default M channel_demonfire Fluffy_Pillow 312080.1/1100000: 28% mana | 3.7/5: 74% soul_shard lord_of_flames
3:30.314 default H conflagrate Fluffy_Pillow 294285.5/1100000: 27% mana | 3.8/5: 76% soul_shard lord_of_flames
3:31.484 default S incinerate Fluffy_Pillow 310806.8/1100000: 28% mana | 4.3/5: 86% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
3:32.492 default N dimensional_rift Fluffy_Pillow 270040.5/1100000: 25% mana | 4.7/5: 94% soul_shard backdraft, lord_of_flames, conflagration_of_chaos
3:33.665 default P chaos_bolt Fluffy_Pillow 286604.2/1100000: 26% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos
3:35.305 default R immolate Fluffy_Pillow 309762.3/1100000: 28% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
3:36.477 default S incinerate Fluffy_Pillow 260311.8/1100000: 24% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
3:37.914 default S incinerate Fluffy_Pillow 225603.4/1100000: 21% mana | 3.4/5: 68% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
3:39.352 default Q conflagrate Fluffy_Pillow 190909.0/1100000: 17% mana | 3.6/5: 72% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
3:40.526 default S incinerate Fluffy_Pillow 207486.8/1100000: 19% mana | 4.2/5: 84% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity
3:41.535 default S incinerate Fluffy_Pillow 166734.7/1100000: 15% mana | 4.4/5: 88% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
3:42.543 default P chaos_bolt Fluffy_Pillow 125968.4/1100000: 11% mana | 4.9/5: 98% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
3:44.883 default S incinerate Fluffy_Pillow 159011.0/1100000: 14% mana | 3.0/5: 60% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
3:46.321 default N dimensional_rift Fluffy_Pillow 124316.7/1100000: 11% mana | 3.3/5: 66% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
3:47.494 default M channel_demonfire Fluffy_Pillow 140880.4/1100000: 13% mana | 3.7/5: 74% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
3:50.114 default Q conflagrate Fluffy_Pillow 125845.3/1100000: 11% mana | 3.8/5: 76% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:51.263 default P chaos_bolt Fluffy_Pillow 142407.2/1100000: 13% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:52.868 default R immolate Fluffy_Pillow 165541.8/1100000: 15% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
3:54.017 default P chaos_bolt Fluffy_Pillow 115950.2/1100000: 11% mana | 3.1/5: 62% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:55.656 default S incinerate Fluffy_Pillow 139094.1/1100000: 13% mana | 1.1/5: 22% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:57.095 default S incinerate Fluffy_Pillow 104413.9/1100000: 9% mana | 1.5/5: 30% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:58.532 default Q conflagrate Fluffy_Pillow 69705.5/1100000: 6% mana | 1.9/5: 38% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
3:59.706 default P chaos_bolt Fluffy_Pillow 86283.3/1100000: 8% mana | 2.4/5: 48% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, concordance_of_the_legionfall
4:01.345 default S incinerate Fluffy_Pillow 109427.2/1100000: 10% mana | 0.6/5: 12% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, concordance_of_the_legionfall
4:02.354 default F use_items Fluffy_Pillow 68675.1/1100000: 6% mana | 0.9/5: 18% soul_shard lord_of_flames, concordance_of_the_legionfall
4:02.354 default N dimensional_rift Fluffy_Pillow 68675.1/1100000: 6% mana | 0.9/5: 18% soul_shard lord_of_flames, concordance_of_the_legionfall
4:03.528 default S incinerate Fluffy_Pillow 85252.9/1100000: 8% mana | 1.4/5: 28% soul_shard lessons_of_spacetime, lord_of_flames, concordance_of_the_legionfall
4:04.965 default L soul_harvest Fluffy_Pillow 50544.4/1100000: 5% mana | 1.6/5: 32% soul_shard lessons_of_spacetime, lord_of_flames
4:05.123 default T life_tap Fluffy_Pillow 52775.5/1100000: 5% mana | 1.8/5: 36% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames
4:06.295 default S incinerate Fluffy_Pillow 399325.0/1100000: 36% mana | 1.8/5: 36% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames
4:07.733 default H conflagrate Fluffy_Pillow 364731.9/1100000: 33% mana | 2.1/5: 42% soul_shard soul_harvest, lessons_of_spacetime, lord_of_flames, mark_of_the_claw
4:08.883 default M channel_demonfire Fluffy_Pillow 381308.1/1100000: 35% mana | 2.6/5: 52% soul_shard soul_harvest, lessons_of_spacetime, backdraft(2), lord_of_flames, mark_of_the_claw
4:11.488 default P chaos_bolt Fluffy_Pillow 366056.9/1100000: 33% mana | 2.8/5: 56% soul_shard soul_harvest, backdraft(2), lord_of_flames, mark_of_the_claw
4:13.096 default D immolate Fluffy_Pillow 389234.8/1100000: 35% mana | 0.9/5: 18% soul_shard soul_harvest, backdraft, lord_of_flames, mark_of_the_claw
4:14.242 default S incinerate Fluffy_Pillow 339502.8/1100000: 31% mana | 0.9/5: 18% soul_shard soul_harvest, backdraft, lord_of_flames
4:15.248 default S incinerate Fluffy_Pillow 298708.3/1100000: 27% mana | 1.2/5: 24% soul_shard soul_harvest, lord_of_flames
4:16.687 default H conflagrate Fluffy_Pillow 264042.5/1100000: 24% mana | 1.6/5: 32% soul_shard soul_harvest, lord_of_flames, mark_of_the_claw
4:17.834 default S incinerate Fluffy_Pillow 280575.5/1100000: 26% mana | 2.1/5: 42% soul_shard soul_harvest, backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw
4:18.821 default P chaos_bolt Fluffy_Pillow 239802.2/1100000: 22% mana | 2.3/5: 46% soul_shard soul_harvest, backdraft, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:20.427 default S incinerate Fluffy_Pillow 262951.3/1100000: 24% mana | 0.5/5: 10% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:21.835 default S incinerate Fluffy_Pillow 228246.3/1100000: 21% mana | 1.0/5: 20% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:23.244 default S incinerate Fluffy_Pillow 193378.0/1100000: 18% mana | 1.2/5: 24% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:24.682 default F use_items Fluffy_Pillow 158683.7/1100000: 14% mana | 1.5/5: 30% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:24.682 default S incinerate Fluffy_Pillow 158683.7/1100000: 14% mana | 1.5/5: 30% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:26.120 default Q conflagrate Fluffy_Pillow 123989.4/1100000: 11% mana | 1.8/5: 36% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:27.290 default R immolate Fluffy_Pillow 140510.7/1100000: 13% mana | 2.3/5: 46% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:28.461 default M channel_demonfire Fluffy_Pillow 91046.1/1100000: 8% mana | 2.4/5: 48% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall
4:31.033 default N dimensional_rift Fluffy_Pillow 74564.7/1100000: 7% mana | 2.6/5: 52% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos
4:32.206 default S incinerate Fluffy_Pillow 91128.4/1100000: 8% mana | 2.9/5: 58% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos
4:33.214 default T life_tap Fluffy_Pillow 50362.1/1100000: 5% mana | 3.2/5: 64% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos
4:34.387 default S incinerate Fluffy_Pillow 396925.8/1100000: 36% mana | 3.2/5: 64% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
4:35.824 default Q conflagrate Fluffy_Pillow 362217.4/1100000: 33% mana | 3.5/5: 70% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
4:36.996 default P chaos_bolt Fluffy_Pillow 378766.9/1100000: 34% mana | 5.0/5: 100% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos, extracted_sanity
4:38.637 default S incinerate Fluffy_Pillow 401939.1/1100000: 37% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos, extracted_sanity
4:39.643 default S incinerate Fluffy_Pillow 361144.6/1100000: 33% mana | 3.2/5: 64% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, extracted_sanity
4:41.082 default S incinerate Fluffy_Pillow 326464.4/1100000: 30% mana | 3.7/5: 74% soul_shard lord_of_flames, conflagration_of_chaos, extracted_sanity
4:42.520 default N dimensional_rift Fluffy_Pillow 291770.1/1100000: 27% mana | 4.2/5: 84% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
4:43.692 default P chaos_bolt Fluffy_Pillow 308319.6/1100000: 28% mana | 4.5/5: 90% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
4:46.034 default P chaos_bolt Fluffy_Pillow 341390.5/1100000: 31% mana | 2.6/5: 52% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity
4:48.374 default D immolate Fluffy_Pillow 374434.2/1100000: 34% mana | 0.7/5: 14% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:49.522 default M channel_demonfire Fluffy_Pillow 324981.6/1100000: 30% mana | 0.8/5: 16% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:52.045 default I conflagrate Fluffy_Pillow 308548.4/1100000: 28% mana | 0.9/5: 18% soul_shard lord_of_flames, conflagration_of_chaos, concordance_of_the_legionfall, mark_of_the_claw
4:53.193 default S incinerate Fluffy_Pillow 325095.8/1100000: 30% mana | 1.6/5: 32% soul_shard backdraft(2), lord_of_flames, conflagration_of_chaos, mark_of_the_claw
4:54.180 default N dimensional_rift Fluffy_Pillow 284322.5/1100000: 26% mana | 1.9/5: 38% soul_shard backdraft, lord_of_flames, conflagration_of_chaos, mark_of_the_claw
4:55.329 default Q conflagrate Fluffy_Pillow 300603.0/1100000: 27% mana | 2.3/5: 46% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos
4:56.502 default S incinerate Fluffy_Pillow 317166.7/1100000: 29% mana | 2.8/5: 56% soul_shard lessons_of_spacetime, backdraft(3), lord_of_flames, conflagration_of_chaos
4:57.509 default S incinerate Fluffy_Pillow 276386.3/1100000: 25% mana | 3.0/5: 60% soul_shard lessons_of_spacetime, backdraft(2), lord_of_flames, conflagration_of_chaos
4:58.517 default S incinerate Fluffy_Pillow 235620.1/1100000: 21% mana | 3.4/5: 68% soul_shard lessons_of_spacetime, backdraft, lord_of_flames, conflagration_of_chaos
4:59.524 default S incinerate Fluffy_Pillow 194839.7/1100000: 18% mana | 3.6/5: 72% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
5:00.961 default S incinerate Fluffy_Pillow 160131.2/1100000: 15% mana | 4.1/5: 82% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
5:02.397 default S incinerate Fluffy_Pillow 125408.7/1100000: 11% mana | 4.4/5: 88% soul_shard lessons_of_spacetime, lord_of_flames, conflagration_of_chaos
5:03.834 default O chaos_bolt Fluffy_Pillow 90700.2/1100000: 8% mana | 4.6/5: 92% soul_shard lord_of_flames, conflagration_of_chaos
5:06.175 default O chaos_bolt Fluffy_Pillow 123757.0/1100000: 11% mana | 3.7/5: 74% soul_shard lord_of_flames, conflagration_of_chaos
5:08.514 default D immolate Fluffy_Pillow 156785.4/1100000: 14% mana | 1.8/5: 36% soul_shard lord_of_flames, conflagration_of_chaos
5:09.683 default M channel_demonfire Fluffy_Pillow 107292.6/1100000: 10% mana | 1.9/5: 38% soul_shard lord_of_flames, conflagration_of_chaos
5:12.213 default I conflagrate Fluffy_Pillow 90218.2/1100000: 8% mana | 2.0/5: 40% soul_shard lord_of_flames, conflagration_of_chaos

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4201 3876 0
Agility 7254 6929 0
Stamina 75895 75895 46630
Intellect 61279 59573 49413 (4609)
Spirit 1 1 0
Health 4553700 4553700 0
Mana 1100000 1100000 0
Soul Shard 5 5 0
Spell Power 61279 59573 0
Crit 23.42% 23.42% 7369
Haste 28.37% 27.37% 10264
Damage / Heal Versatility 8.10% 8.10% 3849
ManaReg per Second 14121 14011 0
Mastery 49.40% 49.40% 6681
Armor 2233 2233 2233
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 938.00
Local Head Diabolic Helm
ilevel: 930, stats: { 281 Armor, +4305 Sta, +2870 Int, +1082 Crit, +766 Mastery }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Lessons of Space-Time
ilevel: 970, stats: { 300 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Chest Diabolic Robe
ilevel: 930, stats: { 346 Armor, +4305 Sta, +2870 Int, +1241 Haste, +607 Vers }
Local Waist Feretory of Souls
ilevel: 970, stats: { 225 Armor, +4687 Sta, +3124 Int, +920 Haste, +690 Mastery }
Local Legs Diabolic Leggings
ilevel: 930, stats: { 303 Armor, +4305 Sta, +2870 Int, +1162 Mastery, +686 Haste }
Local Feet Slippers of Enduring Vigilance
ilevel: 930, stats: { 238 Armor, +3229 Sta, +2153 Int, +931 Haste, +455 Mastery }
Local Wrists Oathbreaker's Cuffs
ilevel: 930, stats: { 151 Armor, +2422 Sta, +1615 Int, +676 Crit, +364 Vers }
Local Hands Gloves of Furtive Oppression
ilevel: 930, stats: { 216 Armor, +3229 Sta, +2153 Int, +812 Crit, +574 Mastery }
Local Finger1 Yathae's Thumb Ring
ilevel: 930, stats: { +2422 Sta, +2414 Crit, +1106 Vers }, enchant: { +200 Haste }
Local Finger2 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Diabolic Shroud
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +676 Crit, +364 Vers }, enchant: { +200 Int }
Local Main Hand Scepter of Sargeras
ilevel: 957, weapon: { 9093 - 13641, 3.6 }, stats: { +3691 Int, +5537 Sta, +1024 Haste, +1024 Mastery, +20134 Int }, relics: { +55 ilevels, +55 ilevels, +55 ilevels }

Talents

Level
15 Backdraft (Destruction Warlock) Roaring Blaze (Destruction Warlock) Shadowburn (Destruction Warlock)
30 Reverse Entropy (Destruction Warlock) Eradication (Destruction Warlock) Empowered Life Tap
45 Demonic Circle Mortal Coil Shadowfury
60 Cataclysm (Destruction Warlock) Fire and Brimstone (Destruction Warlock) Soul Harvest
75 Demon Skin Burning Rush Dark Pact
90 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
100 Wreak Havoc (Destruction Warlock) Channel Demonfire (Destruction Warlock) Soul Conduit

Profile

warlock="baseline"
spec=destruction
level=110
race=troll
role=spell
position=back
talents=1203012
artifact=38:0:0:0:0:803:1:804:4:805:4:806:4:807:4:808:4:809:4:810:4:811:4:812:4:813:1:814:1:815:1:816:1:817:1:818:1:1355:1:1392:1:1609:4:1610:1:1611:1:1612:1:1713:1

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/summon_pet,if=!talent.grimoire_of_supremacy.enabled&(!talent.grimoire_of_sacrifice.enabled|buff.demonic_power.down)
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&artifact.lord_of_flames.rank>0
actions.precombat+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&active_enemies>1
actions.precombat+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&active_enemies=1&artifact.lord_of_flames.rank=0
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/life_tap,if=talent.empowered_life_tap.enabled&!buff.empowered_life_tap.remains
actions.precombat+=/potion,name=prolonged_power
actions.precombat+=/chaos_bolt

# Executed every time the actor is available.
actions=immolate,cycle_targets=1,if=active_enemies=2&talent.roaring_blaze.enabled&!cooldown.havoc.remains&dot.immolate.remains<=buff.active_havoc.duration
actions+=/havoc,target=2,if=active_enemies>1&(active_enemies<4|talent.wreak_havoc.enabled&active_enemies<6)&!debuff.havoc.remains
actions+=/dimensional_rift,if=charges=3
actions+=/cataclysm,if=spell_targets.cataclysm>=3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&remains<=tick_time
actions+=/immolate,cycle_targets=1,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&active_enemies>1&remains<=tick_time&(!talent.roaring_blaze.enabled|(!debuff.roaring_blaze.remains&action.conflagrate.charges<2+set_bonus.tier19_4pc))
actions+=/immolate,if=talent.roaring_blaze.enabled&remains<=duration&!debuff.roaring_blaze.remains&target.time_to_die>10&(action.conflagrate.charges=2+set_bonus.tier19_4pc|(action.conflagrate.charges>=1+set_bonus.tier19_4pc&action.conflagrate.recharge_time<cast_time+gcd)|target.time_to_die<24)
actions+=/berserking
actions+=/blood_fury
actions+=/use_items
actions+=/potion,name=deadly_grace,if=(buff.soul_harvest.remains|trinket.proc.any.react|target.time_to_die<=45)
actions+=/shadowburn,if=buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/shadowburn,if=(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/conflagrate,if=talent.roaring_blaze.enabled&(charges=2+set_bonus.tier19_4pc|(charges>=1+set_bonus.tier19_4pc&recharge_time<gcd)|target.time_to_die<24)
actions+=/conflagrate,if=talent.roaring_blaze.enabled&debuff.roaring_blaze.stack>0&dot.immolate.remains>dot.immolate.duration*0.3&(active_enemies=1|soul_shard<3)&soul_shard<5
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&buff.conflagration_of_chaos.remains<=action.chaos_bolt.cast_time
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3&(charges=1+set_bonus.tier19_4pc&recharge_time<action.chaos_bolt.cast_time|charges=2+set_bonus.tier19_4pc)&soul_shard<5
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<=gcd
actions+=/dimensional_rift,if=equipped.144369&!buff.lessons_of_spacetime.remains&((!talent.grimoire_of_supremacy.enabled&!cooldown.summon_doomguard.remains)|(talent.grimoire_of_service.enabled&!cooldown.service_pet.remains)|(talent.soul_harvest.enabled&!cooldown.soul_harvest.remains))
actions+=/service_pet
actions+=/summon_infernal,if=artifact.lord_of_flames.rank>0&!buff.lord_of_flames.remains
actions+=/summon_doomguard,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening<=2&(target.time_to_die>180|target.health.pct<=20|target.time_to_die<30)
actions+=/summon_infernal,if=!talent.grimoire_of_supremacy.enabled&spell_targets.infernal_awakening>2
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&artifact.lord_of_flames.rank>0&buff.lord_of_flames.remains&!pet.doomguard.active
actions+=/summon_doomguard,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal=1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/summon_infernal,if=talent.grimoire_of_supremacy.enabled&spell_targets.summon_infernal>1&equipped.132379&!cooldown.sindorei_spite_icd.remains
actions+=/soul_harvest,if=!buff.soul_harvest.remains
actions+=/chaos_bolt,if=active_enemies<4&buff.active_havoc.remains>cast_time
actions+=/channel_demonfire,if=dot.immolate.remains>cast_time&(active_enemies=1|buff.active_havoc.remains<action.chaos_bolt.cast_time)
actions+=/rain_of_fire,if=active_enemies>=3
actions+=/rain_of_fire,if=active_enemies>=6&talent.wreak_havoc.enabled
actions+=/dimensional_rift,if=target.time_to_die<=32|!equipped.144369|charges>1|((!talent.grimoire_of_service.enabled|recharge_time<cooldown.service_pet.remains)&(!talent.soul_harvest.enabled|recharge_time<cooldown.soul_harvest.remains)&(!talent.grimoire_of_supremacy.enabled|recharge_time<cooldown.summon_doomguard.remains))
actions+=/life_tap,if=talent.empowered_life_tap.enabled&buff.empowered_life_tap.remains<duration*0.3
actions+=/cataclysm
actions+=/chaos_bolt,if=active_enemies<3&target.time_to_die<=10
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(soul_shard>=5-spell_targets.infernal_awakening*0.5|buff.soul_harvest.remains>cast_time|buff.concordance_of_the_legionfall.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.proc.mastery.react&trinket.proc.mastery.remains>cast_time|trinket.proc.crit.react&trinket.proc.crit.remains>cast_time|trinket.proc.versatility.react&trinket.proc.versatility.remains>cast_time|trinket.proc.intellect.react&trinket.proc.intellect.remains>cast_time|trinket.proc.spell_power.react&trinket.proc.spell_power.remains>cast_time)
actions+=/chaos_bolt,if=active_enemies<3&(cooldown.havoc.remains>12&cooldown.havoc.remains|active_enemies=1|soul_shard>=5-spell_targets.infernal_awakening*0.5)&(trinket.stacking_proc.mastery.react&trinket.stacking_proc.mastery.remains>cast_time|trinket.stacking_proc.crit.react&trinket.stacking_proc.crit.remains>cast_time|trinket.stacking_proc.versatility.react&trinket.stacking_proc.versatility.remains>cast_time|trinket.stacking_proc.intellect.react&trinket.stacking_proc.intellect.remains>cast_time|trinket.stacking_proc.spell_power.react&trinket.stacking_proc.spell_power.remains>cast_time)
actions+=/shadowburn
actions+=/conflagrate,if=!talent.roaring_blaze.enabled&buff.backdraft.stack<3
actions+=/immolate,if=(active_enemies<5|!talent.fire_and_brimstone.enabled)&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>=action.immolate.cast_time*active_enemies)&!talent.roaring_blaze.enabled&remains<=duration*0.3
actions+=/incinerate
actions+=/life_tap

head=diabolic_helm,id=147183,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant_id=5437
shoulders=lessons_of_spacetime,id=144369,ilevel=970
back=diabolic_shroud,id=147181,ilevel=930,enchant_id=5436
chest=diabolic_robe,id=147185,ilevel=930
wrists=oathbreakers_cuffs,id=147001,ilevel=930
hands=gloves_of_furtive_oppression,id=146988,ilevel=930
waist=feretory_of_souls,id=132456,ilevel=970
legs=diabolic_leggings,id=147184,ilevel=930
feet=slippers_of_enduring_vigilance,id=146987,ilevel=930
finger1=yathaes_thumb_ring,id=147021,ilevel=930,enchant_id=5428
finger2=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant_id=5428
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=scepter_of_sargeras,id=128941,ilevel=957,gem_id=147087/147090/147087

# Gear Summary
# gear_ilvl=938.47
# gear_stamina=46630
# gear_intellect=49413
# gear_crit_rating=7369
# gear_haste_rating=10264
# gear_mastery_rating=6681
# gear_versatility_rating=3849
# gear_armor=2233
default_pet=imp

Simulation & Raid Information

Iterations: 2500
Threads: 3
Confidence: 95.00%
Fight Length: 210 - 423 ( 301.3 )

Performance:

Total Events Processed: 107694430
Max Event Queue: 157
Sim Seconds: 753130
CPU Seconds: 112.2656
Physical Seconds: 64.0802
Speed Up: 6708

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
T19 2pc T19 2pc augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.61sec
T19 2pc T19 2pc berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.50sec 0 301.61sec
T19 2pc T19 2pc channel_demonfire 196447 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 19.03sec 0 301.61sec
T19 2pc T19 2pc channel_demonfire_tick 196448 48897261 162121 47.31 165158 330193 0.0 237.8 24.5% 0.0% 0.0% 0.0% 0.00sec 48897261 301.61sec
T19 2pc T19 2pc chaos_bolt 116858 99169654 328802 7.86 0 2510946 38.7 39.5 100.0% 0.0% 0.0% 0.0% 7.69sec 99169654 301.61sec
T19 2pc T19 2pc conflagrate 17962 32518260 107816 7.03 491575 1184076 35.3 35.3 61.9% 0.0% 0.0% 0.0% 8.60sec 32518260 301.61sec
T19 2pc T19 2pc deadly_grace 188091 1950943 6468 2.77 112750 225102 13.9 13.9 24.4% 0.0% 0.0% 0.0% 2.13sec 1950943 301.61sec
T19 2pc T19 2pc dimensional_rift 196586 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 22.98sec 0 301.61sec
T19 2pc T19 2pc flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.61sec
T19 2pc T19 2pc food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.61sec
T19 2pc T19 2pc immolate 348 7256092 24058 3.42 267755 533296 17.2 17.2 57.9% 0.0% 0.0% 0.0% 17.92sec 32928682 301.61sec
T19 2pc T19 2pc immolate ticks -348 25672590 85575 27.23 119771 239075 17.2 136.1 57.7% 0.0% 0.0% 0.0% 17.92sec 32928682 301.61sec
T19 2pc T19 2pc incinerate 29722 55687227 184634 20.03 440344 877424 101.1 100.7 25.8% 0.0% 0.0% 0.0% 2.89sec 55687227 301.61sec
T19 2pc T19 2pc insidious_corruption ticks -243941 4100765 13669 8.57 77103 154132 5.1 42.9 24.1% 0.0% 0.0% 0.0% 60.48sec 4100765 301.61sec
T19 2pc T19 2pc life_tap 1454 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 33.79sec 0 301.61sec
T19 2pc T19 2pc potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.61sec
T19 2pc T19 2pc soul_harvest 196098 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.38sec 0 301.61sec
T19 2pc T19 2pc spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.40sec 0 301.61sec
T19 2pc T19 2pc spectral_blast 246442 6853056 22722 6.60 166577 333340 33.4 33.2 23.9% 0.0% 0.0% 0.0% 8.00sec 6853056 301.61sec
T19 2pc T19 2pc spectral_bolt 242571 15249593 50561 17.04 143305 286470 86.1 85.7 24.2% 0.0% 0.0% 0.0% 3.06sec 15249593 301.61sec
T19 2pc T19 2pc summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.61sec
T19 2pc T19 2pc summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.61sec
T19 2pc T19 2pc_infernal immolation ticks -19483 145297 484 0.40 58285 116601 1.0 2.0 24.6% 0.0% 0.0% 0.0% 0.00sec 145297 3.22sec
T19 2pc T19 2pc_infernal melee 0 87774 27245 37.25 34916 69753 2.0 2.0 25.8% 0.0% 0.0% 0.0% 1.19sec 129036 3.22sec
T19 2pc T19 2pc_infernal meteor_strike 171018 111400 34578 18.62 89632 179619 1.0 1.0 24.2% 0.0% 0.0% 0.0% 0.00sec 111400 3.22sec
T19 2pc T19 2pc_doomguard doom_bolt 85692 46350547 155337 26.88 276287 551312 134.4 133.7 25.6% 0.0% 0.0% 0.0% 2.22sec 46350547 298.39sec
T19 2pc T19 2pc_lord_of_flames_infernal immolation ticks -19483 5166336 17221 13.20 62980 125940 3.0 66.0 24.3% 0.0% 0.0% 0.0% 0.00sec 5166336 25.00sec
T19 2pc T19 2pc_lord_of_flames_infernal melee 0 3085736 123425 158.39 37694 75345 66.0 66.0 24.1% 0.0% 0.0% 0.0% 1.12sec 4536325 25.00sec
T19 2pc T19 2pc_shadowy_tear shadow_bolt ticks -196657 7835668 26119 7.30 172477 342994 3.6 36.5 25.5% 0.0% 0.0% 0.0% 67.47sec 7835668 45.17sec
T19 2pc T19 2pc_flame_rift searing_bolt 243050 6438206 72823 48.14 90768 0 71.3 70.9 0.0% 0.0% 0.0% 0.0% 2.59sec 21223541 88.41sec
T19 2pc T19 2pc_flame_rift searing_bolt ticks -243050 14785336 49284 22.43 105347 209895 71.3 112.1 25.3% 0.0% 0.0% 0.0% 2.59sec 21223541 88.41sec
T19 2pc T19 2pc_chaos_tear chaos_bolt 215279 6537405 368520 12.19 0 1813511 3.6 3.6 100.0% 0.0% 0.0% 0.0% 67.54sec 6537405 17.74sec
T19 2pc T19 2pc_chaos_portal chaos_barrage ticks -187394 7144425 23815 22.93 49976 99644 3.6 114.6 25.5% 0.0% 0.0% 0.0% 66.73sec 7144425 19.32sec
T19 2pc - T20 4pc T19 2pc - T20 4pc augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.54sec 0 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc channel_demonfire 196447 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 19.05sec 0 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc channel_demonfire_tick 196448 49291411 163823 47.37 166555 333008 0.0 237.5 24.6% 0.0% 0.0% 0.0% 0.00sec 49291411 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc chaos_bolt 116858 120604651 400838 8.71 0 2760209 42.9 43.7 100.0% 0.0% 0.0% 0.0% 6.91sec 120604651 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc conflagrate 17962 32634307 108462 7.03 493986 1193203 35.3 35.3 61.7% 0.0% 0.0% 0.0% 8.60sec 32634307 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc deadly_grace 188091 1959705 6513 2.77 112737 225735 13.9 13.9 25.0% 0.0% 0.0% 0.0% 2.13sec 1959705 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc dimensional_rift 196586 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 23.15sec 0 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc immolate 348 7273020 24172 3.42 269412 537456 17.2 17.2 57.6% 0.0% 0.0% 0.0% 17.92sec 33084446 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc immolate ticks -348 25811425 86038 27.17 120646 240956 17.2 135.9 57.6% 0.0% 0.0% 0.0% 17.92sec 33084446 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc incinerate 29722 53573404 178055 19.18 443592 884177 96.6 96.2 25.7% 0.0% 0.0% 0.0% 3.02sec 53573404 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc insidious_corruption ticks -243941 4097863 13660 8.56 77030 154050 5.1 42.8 24.3% 0.0% 0.0% 0.0% 60.50sec 4097863 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc life_tap 1454 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 36.71sec 0 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc soul_harvest 196098 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.42sec 0 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.40sec 0 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc spectral_blast 246442 6858050 22793 6.61 166606 332874 33.4 33.1 24.2% 0.0% 0.0% 0.0% 7.97sec 6858050 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc spectral_bolt 242571 15216208 50572 17.03 143312 286674 85.8 85.4 24.3% 0.0% 0.0% 0.0% 3.05sec 15216208 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.88sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_infernal immolation ticks -19483 145256 484 0.40 58286 116705 1.0 2.0 24.5% 0.0% 0.0% 0.0% 0.00sec 145256 3.22sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_infernal melee 0 87487 27183 37.28 34910 69838 2.0 2.0 25.3% 0.0% 0.0% 0.0% 1.19sec 128614 3.22sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_infernal meteor_strike 171018 112696 35015 18.64 89730 179192 1.0 1.0 25.7% 0.0% 0.0% 0.0% 0.00sec 112696 3.22sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_doomguard doom_bolt 85692 46239060 155340 26.88 276347 550477 134.1 133.4 25.7% 0.0% 0.0% 0.0% 2.22sec 46239060 297.66sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_lord_of_flames_infernal immolation ticks -19483 5159399 17198 13.20 62957 125918 3.0 66.0 24.2% 0.0% 0.0% 0.0% 0.00sec 5159399 25.00sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_lord_of_flames_infernal melee 0 3089399 123571 158.39 37681 75465 66.0 66.0 24.2% 0.0% 0.0% 0.0% 1.12sec 4541710 25.00sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_shadowy_tear shadow_bolt ticks -196657 7706191 25687 7.19 172410 343265 3.6 36.0 25.3% 0.0% 0.0% 0.0% 66.82sec 7706191 44.58sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_flame_rift searing_bolt 243050 6469720 73978 48.86 90838 0 71.7 71.2 0.0% 0.0% 0.0% 0.0% 2.61sec 21272774 87.46sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_flame_rift searing_bolt ticks -243050 14803054 49344 22.43 105446 209981 71.7 112.1 25.4% 0.0% 0.0% 0.0% 2.61sec 21272774 87.46sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_chaos_tear chaos_bolt 215279 6456531 369221 12.19 0 1816809 3.6 3.6 100.0% 0.0% 0.0% 0.0% 68.48sec 6456531 17.49sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_chaos_portal chaos_barrage ticks -187394 7015457 23385 22.52 49977 99551 3.6 112.6 25.3% 0.0% 0.0% 0.0% 67.28sec 7015457 19.03sec
T19 4pc T19 4pc augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.34sec
T19 4pc T19 4pc berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.51sec 0 301.34sec
T19 4pc T19 4pc channel_demonfire 196447 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 19.06sec 0 301.34sec
T19 4pc T19 4pc channel_demonfire_tick 196448 48707789 161640 46.93 165649 331275 0.0 235.7 24.8% 0.0% 0.0% 0.0% 0.00sec 48707789 301.34sec
T19 4pc T19 4pc chaos_bolt 116858 104285712 346078 8.23 0 2523963 40.5 41.3 100.0% 0.0% 0.0% 0.0% 7.32sec 104285712 301.34sec
T19 4pc T19 4pc conflagrate 17962 39534515 131198 8.55 492068 1186097 42.9 42.9 61.8% 0.0% 0.0% 0.0% 7.05sec 39534515 301.34sec
T19 4pc T19 4pc deadly_grace 188091 1965380 6522 2.79 112906 225487 14.0 14.0 24.4% 0.0% 0.0% 0.0% 2.12sec 1965380 301.34sec
T19 4pc T19 4pc dimensional_rift 196586 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 22.97sec 0 301.34sec
T19 4pc T19 4pc flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.34sec
T19 4pc T19 4pc food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.34sec
T19 4pc T19 4pc immolate 348 7263432 24104 3.43 268877 535750 17.2 17.2 57.5% 0.0% 0.0% 0.0% 17.92sec 32997160 301.34sec
T19 4pc T19 4pc immolate ticks -348 25733728 85779 27.25 119947 239513 17.2 136.3 57.6% 0.0% 0.0% 0.0% 17.92sec 32997160 301.34sec
T19 4pc T19 4pc incinerate 29722 54290119 180165 19.47 441702 881212 98.2 97.8 25.8% 0.0% 0.0% 0.0% 2.98sec 54290119 301.34sec
T19 4pc T19 4pc insidious_corruption ticks -243941 4103086 13677 8.57 77185 154042 5.1 42.8 24.2% 0.0% 0.0% 0.0% 60.51sec 4103086 301.34sec
T19 4pc T19 4pc life_tap 1454 0 0 0.00 0 0 6.3 0.0 0.0% 0.0% 0.0% 0.0% 35.38sec 0 301.34sec
T19 4pc T19 4pc potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.34sec
T19 4pc T19 4pc soul_harvest 196098 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.18sec 0 301.34sec
T19 4pc T19 4pc spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.42sec 0 301.34sec
T19 4pc T19 4pc spectral_blast 246442 6831110 22669 6.57 166676 333153 33.2 33.0 24.1% 0.0% 0.0% 0.0% 7.96sec 6831110 301.34sec
T19 4pc T19 4pc spectral_bolt 242571 15216781 50498 17.02 143293 286341 85.8 85.5 24.3% 0.0% 0.0% 0.0% 3.03sec 15216781 301.34sec
T19 4pc T19 4pc summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.34sec
T19 4pc T19 4pc summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.34sec
T19 4pc T19 4pc_infernal immolation ticks -19483 145747 486 0.40 58287 116514 1.0 2.0 25.1% 0.0% 0.0% 0.0% 0.00sec 145747 3.21sec
T19 4pc T19 4pc_infernal melee 0 86991 27061 37.33 34899 69773 2.0 2.0 24.6% 0.0% 0.0% 0.0% 1.19sec 127886 3.21sec
T19 4pc T19 4pc_infernal meteor_strike 171018 112977 35145 18.66 89646 179407 1.0 1.0 26.0% 0.0% 0.0% 0.0% 0.00sec 112977 3.21sec
T19 4pc T19 4pc_doomguard doom_bolt 85692 46282899 155249 26.88 276340 550874 134.3 133.5 25.6% 0.0% 0.0% 0.0% 2.22sec 46282899 298.12sec
T19 4pc T19 4pc_lord_of_flames_infernal immolation ticks -19483 5162109 17207 13.20 62949 125894 3.0 66.0 24.3% 0.0% 0.0% 0.0% 0.00sec 5162109 25.00sec
T19 4pc T19 4pc_lord_of_flames_infernal melee 0 3089096 123559 158.39 37687 75369 66.0 66.0 24.2% 0.0% 0.0% 0.0% 1.12sec 4541264 25.00sec
T19 4pc T19 4pc_shadowy_tear shadow_bolt ticks -196657 7766794 25889 7.25 172286 343321 3.6 36.2 25.2% 0.0% 0.0% 0.0% 68.24sec 7766794 44.84sec
T19 4pc T19 4pc_flame_rift searing_bolt 243050 6349863 72343 47.85 90719 0 70.5 70.0 0.0% 0.0% 0.0% 0.0% 2.63sec 20902984 87.77sec
T19 4pc T19 4pc_flame_rift searing_bolt ticks -243050 14553121 48510 22.06 105213 210305 70.5 110.3 25.5% 0.0% 0.0% 0.0% 2.63sec 20902984 87.77sec
T19 4pc T19 4pc_chaos_tear chaos_bolt 215279 6515201 368780 12.20 0 1813685 3.6 3.6 100.0% 0.0% 0.0% 0.0% 68.37sec 6515201 17.67sec
T19 4pc T19 4pc_chaos_portal chaos_barrage ticks -187394 6992760 23309 22.52 49819 99354 3.6 112.6 25.4% 0.0% 0.0% 0.0% 66.36sec 6992760 19.00sec
T19 4pc - T20 2pc T19 4pc - T20 2pc augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.51sec 0 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc channel_demonfire 196447 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 19.06sec 0 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc channel_demonfire_tick 196448 49192255 163305 47.10 166775 333636 0.0 236.5 24.7% 0.0% 0.0% 0.0% 0.00sec 49192255 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc chaos_bolt 116858 115551794 383602 9.06 0 2541047 44.7 45.5 100.0% 0.0% 0.0% 0.0% 6.63sec 115551794 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc conflagrate 17962 39840243 132259 8.55 495502 1193314 42.9 42.9 62.0% 0.0% 0.0% 0.0% 7.05sec 39840243 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc deadly_grace 188091 1968692 6536 2.78 112903 225901 14.0 14.0 24.7% 0.0% 0.0% 0.0% 2.12sec 1968692 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc dimensional_rift 196586 0 0 0.00 0 0 13.9 0.0 0.0% 0.0% 0.0% 0.0% 23.52sec 0 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc immolate 348 7308271 24262 3.43 270686 539849 17.2 17.2 57.3% 0.0% 0.0% 0.0% 17.91sec 33232580 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc immolate ticks -348 25924309 86414 27.26 120819 241232 17.2 136.3 57.6% 0.0% 0.0% 0.0% 17.91sec 33232580 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc incinerate 29722 52431440 174059 18.66 444798 886455 94.1 93.7 26.0% 0.0% 0.0% 0.0% 3.10sec 52431440 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc insidious_corruption ticks -243941 4101164 13671 8.57 77082 154112 5.1 42.8 24.2% 0.0% 0.0% 0.0% 60.51sec 4101164 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc life_tap 1454 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 38.21sec 0 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc soul_harvest 196098 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.19sec 0 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.45sec 0 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc spectral_blast 246442 6830355 22675 6.57 166655 333262 33.2 33.0 24.3% 0.0% 0.0% 0.0% 7.97sec 6830355 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc spectral_bolt 242571 15203502 50472 17.00 143233 286742 85.7 85.4 24.3% 0.0% 0.0% 0.0% 3.04sec 15203502 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_infernal immolation ticks -19483 145623 485 0.40 58311 116515 1.0 2.0 24.9% 0.0% 0.0% 0.0% 0.00sec 145623 3.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_infernal melee 0 86336 26736 37.16 34922 69789 2.0 2.0 23.6% 0.0% 0.0% 0.0% 1.19sec 126922 3.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_infernal meteor_strike 171018 111339 34479 18.58 89703 179288 1.0 1.0 24.1% 0.0% 0.0% 0.0% 0.00sec 111339 3.23sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_doomguard doom_bolt 85692 46322061 155443 26.88 276097 551195 134.3 133.5 25.8% 0.0% 0.0% 0.0% 2.22sec 46322061 298.00sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_lord_of_flames_infernal immolation ticks -19483 5163374 17211 13.20 62952 125907 3.0 66.0 24.3% 0.0% 0.0% 0.0% 0.00sec 5163374 25.00sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_lord_of_flames_infernal melee 0 3089860 123589 158.39 37696 75327 66.0 66.0 24.2% 0.0% 0.0% 0.0% 1.12sec 4542387 25.00sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_shadowy_tear shadow_bolt ticks -196657 7741394 25805 7.22 172278 344510 3.6 36.1 25.1% 0.0% 0.0% 0.0% 68.17sec 7741394 44.86sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_flame_rift searing_bolt 243050 6303427 72027 47.58 90825 0 69.8 69.4 0.0% 0.0% 0.0% 0.0% 2.64sec 20693958 87.51sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_flame_rift searing_bolt ticks -243050 14390530 47968 21.83 105246 209906 69.8 109.2 25.4% 0.0% 0.0% 0.0% 2.64sec 20693958 87.51sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_chaos_tear chaos_bolt 215279 6286363 368143 12.19 0 1812738 3.5 3.5 100.0% 0.0% 0.0% 0.0% 69.24sec 6286363 17.08sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_chaos_portal chaos_barrage ticks -187394 6950195 23167 22.37 49893 99427 3.6 111.9 25.3% 0.0% 0.0% 0.0% 67.83sec 6950195 18.89sec
T20 2pc T20 2pc augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.23sec
T20 2pc T20 2pc berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.53sec 0 301.23sec
T20 2pc T20 2pc channel_demonfire 196447 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 19.09sec 0 301.23sec
T20 2pc T20 2pc channel_demonfire_tick 196448 49132255 163106 47.11 166723 333227 0.0 236.5 24.6% 0.0% 0.0% 0.0% 0.00sec 49132255 301.23sec
T20 2pc T20 2pc chaos_bolt 116858 107037842 355336 8.41 0 2535005 41.4 42.2 100.0% 0.0% 0.0% 0.0% 7.18sec 107037842 301.23sec
T20 2pc T20 2pc conflagrate 17962 32657134 108413 7.02 493930 1195445 35.3 35.3 61.6% 0.0% 0.0% 0.0% 8.60sec 32657134 301.23sec
T20 2pc T20 2pc deadly_grace 188091 1937272 6431 2.76 112575 225135 13.8 13.8 24.3% 0.0% 0.0% 0.0% 2.12sec 1937272 301.23sec
T20 2pc T20 2pc dimensional_rift 196586 0 0 0.00 0 0 13.7 0.0 0.0% 0.0% 0.0% 0.0% 23.92sec 0 301.23sec
T20 2pc T20 2pc flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.23sec
T20 2pc T20 2pc food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.23sec
T20 2pc T20 2pc immolate 348 7285024 24184 3.42 269406 537982 17.2 17.2 57.7% 0.0% 0.0% 0.0% 17.95sec 33138163 301.23sec
T20 2pc T20 2pc immolate ticks -348 25853139 86177 27.24 120563 240859 17.2 136.2 57.6% 0.0% 0.0% 0.0% 17.95sec 33138163 301.23sec
T20 2pc T20 2pc incinerate 29722 49822160 165396 17.87 441953 881201 90.1 89.7 25.8% 0.0% 0.0% 0.0% 3.23sec 49822160 301.23sec
T20 2pc T20 2pc insidious_corruption ticks -243941 4092141 13640 8.56 76917 153979 5.1 42.8 24.3% 0.0% 0.0% 0.0% 60.55sec 4092141 301.23sec
T20 2pc T20 2pc life_tap 1454 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 41.63sec 0 301.23sec
T20 2pc T20 2pc potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.23sec
T20 2pc T20 2pc soul_harvest 196098 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.50sec 0 301.23sec
T20 2pc T20 2pc spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.48sec 0 301.23sec
T20 2pc T20 2pc spectral_blast 246442 6794113 22555 6.56 166484 332513 33.1 32.9 24.1% 0.0% 0.0% 0.0% 7.99sec 6794113 301.23sec
T20 2pc T20 2pc spectral_bolt 242571 15193483 50438 17.03 143185 286588 85.9 85.5 24.1% 0.0% 0.0% 0.0% 3.04sec 15193483 301.23sec
T20 2pc T20 2pc summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.23sec
T20 2pc T20 2pc summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.23sec
T20 2pc T20 2pc_infernal immolation ticks -19483 144451 482 0.40 58280 116522 1.0 2.0 23.9% 0.0% 0.0% 0.0% 0.00sec 144451 3.23sec
T20 2pc T20 2pc_infernal melee 0 87205 27038 37.21 34893 69889 2.0 2.0 24.9% 0.0% 0.0% 0.0% 1.19sec 128199 3.23sec
T20 2pc T20 2pc_infernal meteor_strike 171018 111886 34690 18.60 89688 179105 1.0 1.0 24.8% 0.0% 0.0% 0.0% 0.00sec 111886 3.23sec
T20 2pc T20 2pc_doomguard doom_bolt 85692 46223916 155111 26.88 276085 550796 134.3 133.5 25.5% 0.0% 0.0% 0.0% 2.22sec 46223916 298.00sec
T20 2pc T20 2pc_lord_of_flames_infernal immolation ticks -19483 5154971 17183 13.20 62900 125807 3.0 66.0 24.2% 0.0% 0.0% 0.0% 0.00sec 5154971 25.00sec
T20 2pc T20 2pc_lord_of_flames_infernal melee 0 3092216 123684 158.39 37669 75363 66.0 66.0 24.4% 0.0% 0.0% 0.0% 1.12sec 4545851 25.00sec
T20 2pc T20 2pc_shadowy_tear shadow_bolt ticks -196657 7620782 25403 7.11 172140 344021 3.5 35.6 25.3% 0.0% 0.0% 0.0% 68.40sec 7620782 44.26sec
T20 2pc T20 2pc_flame_rift searing_bolt 243050 6226306 72282 47.73 90867 0 68.9 68.5 0.0% 0.0% 0.0% 0.0% 2.58sec 20561539 86.14sec
T20 2pc T20 2pc_flame_rift searing_bolt ticks -243050 14335233 47784 21.72 105323 209946 68.9 108.6 25.5% 0.0% 0.0% 0.0% 2.58sec 20561539 86.14sec
T20 2pc T20 2pc_chaos_tear chaos_bolt 215279 6220106 368091 12.18 0 1813544 3.4 3.4 100.0% 0.0% 0.0% 0.0% 69.68sec 6220106 16.90sec
T20 2pc T20 2pc_chaos_portal chaos_barrage ticks -187394 7022462 23408 22.52 50024 99670 3.6 112.6 25.3% 0.0% 0.0% 0.0% 68.14sec 7022462 18.92sec
T20 4pc T20 4pc augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.05sec
T20 4pc T20 4pc berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.55sec 0 301.05sec
T20 4pc T20 4pc channel_demonfire 196447 0 0 0.00 0 0 16.0 0.0 0.0% 0.0% 0.0% 0.0% 19.10sec 0 301.05sec
T20 4pc T20 4pc channel_demonfire_tick 196448 49184607 163374 47.19 166690 333201 0.0 236.8 24.7% 0.0% 0.0% 0.0% 0.00sec 49184607 301.05sec
T20 4pc T20 4pc chaos_bolt 116858 116389928 386608 8.40 0 2760378 41.3 42.2 100.0% 0.0% 0.0% 0.0% 7.18sec 116389928 301.05sec
T20 4pc T20 4pc conflagrate 17962 32642668 108428 7.03 494359 1194502 35.3 35.3 61.6% 0.0% 0.0% 0.0% 8.60sec 32642668 301.05sec
T20 4pc T20 4pc deadly_grace 188091 1939122 6441 2.76 112712 224800 13.8 13.8 24.5% 0.0% 0.0% 0.0% 2.12sec 1939122 301.05sec
T20 4pc T20 4pc dimensional_rift 196586 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 23.94sec 0 301.05sec
T20 4pc T20 4pc flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.05sec
T20 4pc T20 4pc food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.05sec
T20 4pc T20 4pc immolate 348 7288754 24211 3.42 269125 537710 17.2 17.2 57.9% 0.0% 0.0% 0.0% 17.94sec 33112190 301.05sec
T20 4pc T20 4pc immolate ticks -348 25823436 86078 27.22 120533 240760 17.2 136.1 57.5% 0.0% 0.0% 0.0% 17.94sec 33112190 301.05sec
T20 4pc T20 4pc incinerate 29722 49840564 165553 17.90 441982 882059 90.2 89.8 25.7% 0.0% 0.0% 0.0% 3.24sec 49840564 301.05sec
T20 4pc T20 4pc insidious_corruption ticks -243941 4088837 13629 8.56 76951 154010 5.1 42.8 24.1% 0.0% 0.0% 0.0% 60.54sec 4088837 301.05sec
T20 4pc T20 4pc life_tap 1454 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 41.56sec 0 301.05sec
T20 4pc T20 4pc potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.05sec
T20 4pc T20 4pc soul_harvest 196098 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.52sec 0 301.05sec
T20 4pc T20 4pc spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.46sec 0 301.05sec
T20 4pc T20 4pc spectral_blast 246442 6797495 22579 6.54 166369 333297 33.0 32.8 24.4% 0.0% 0.0% 0.0% 8.02sec 6797495 301.05sec
T20 4pc T20 4pc spectral_bolt 242571 15182802 50432 17.01 143144 286453 85.7 85.3 24.3% 0.0% 0.0% 0.0% 3.04sec 15182802 301.05sec
T20 4pc T20 4pc summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.05sec
T20 4pc T20 4pc summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.05sec
T20 4pc T20 4pc_infernal immolation ticks -19483 144767 483 0.40 58265 116583 1.0 2.0 24.2% 0.0% 0.0% 0.0% 0.00sec 144767 3.21sec
T20 4pc T20 4pc_infernal melee 0 87181 27133 37.35 34892 69785 2.0 2.0 24.9% 0.0% 0.0% 0.0% 1.19sec 128164 3.21sec
T20 4pc T20 4pc_infernal meteor_strike 171018 112030 34866 18.67 89603 179569 1.0 1.0 24.9% 0.0% 0.0% 0.0% 0.00sec 112030 3.21sec
T20 4pc T20 4pc_doomguard doom_bolt 85692 46248835 155280 26.88 275964 550863 134.2 133.4 25.7% 0.0% 0.0% 0.0% 2.22sec 46248835 297.84sec
T20 4pc T20 4pc_lord_of_flames_infernal immolation ticks -19483 5158139 17194 13.20 62926 125792 3.0 66.0 24.2% 0.0% 0.0% 0.0% 0.00sec 5158139 25.00sec
T20 4pc T20 4pc_lord_of_flames_infernal melee 0 3089235 123564 158.39 37688 75359 66.0 66.0 24.2% 0.0% 0.0% 0.0% 1.12sec 4541468 25.00sec
T20 4pc T20 4pc_shadowy_tear shadow_bolt ticks -196657 7548418 25161 7.03 172663 344024 3.5 35.2 25.3% 0.0% 0.0% 0.0% 68.95sec 7548418 43.90sec
T20 4pc T20 4pc_flame_rift searing_bolt 243050 6230078 71936 47.53 90810 0 69.0 68.6 0.0% 0.0% 0.0% 0.0% 2.66sec 20515579 86.61sec
T20 4pc T20 4pc_flame_rift searing_bolt ticks -243050 14285501 47618 21.65 105276 209980 69.0 108.3 25.5% 0.0% 0.0% 0.0% 2.66sec 20515579 86.61sec
T20 4pc T20 4pc_chaos_tear chaos_bolt 215279 6297101 367288 12.14 0 1815241 3.5 3.5 100.0% 0.0% 0.0% 0.0% 69.84sec 6297101 17.14sec
T20 4pc T20 4pc_chaos_portal chaos_barrage ticks -187394 6879959 22933 22.06 49976 99477 3.5 110.3 25.6% 0.0% 0.0% 0.0% 69.22sec 6879959 18.54sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.42sec
baseline baseline berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.53sec 0 301.42sec
baseline baseline channel_demonfire 196447 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 19.08sec 0 301.42sec
baseline baseline channel_demonfire_tick 196448 48924202 162310 47.16 165658 331297 0.0 236.9 24.7% 0.0% 0.0% 0.0% 0.00sec 48924202 301.42sec
baseline baseline chaos_bolt 116858 96669184 320707 7.65 0 2516199 37.6 38.4 100.0% 0.0% 0.0% 0.0% 7.93sec 96669184 301.42sec
baseline baseline conflagrate 17962 32558003 108014 7.02 491997 1188890 35.3 35.3 61.8% 0.0% 0.0% 0.0% 8.60sec 32558003 301.42sec
baseline baseline deadly_grace 188091 1936632 6425 2.75 112686 225152 13.8 13.8 24.4% 0.0% 0.0% 0.0% 2.12sec 1936632 301.42sec
baseline baseline dimensional_rift 196586 0 0 0.00 0 0 14.0 0.0 0.0% 0.0% 0.0% 0.0% 23.22sec 0 301.42sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.42sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.42sec
baseline baseline immolate 348 7231569 23991 3.42 267824 533591 17.2 17.2 57.5% 0.0% 0.0% 0.0% 17.95sec 32896265 301.42sec
baseline baseline immolate ticks -348 25664695 85549 27.24 119728 239130 17.2 136.2 57.5% 0.0% 0.0% 0.0% 17.95sec 32896265 301.42sec
baseline baseline incinerate 29722 52308782 173538 18.85 439076 875330 95.1 94.7 26.0% 0.0% 0.0% 0.0% 3.06sec 52308782 301.42sec
baseline baseline insidious_corruption ticks -243941 4098405 13661 8.56 77029 153865 5.1 42.8 24.3% 0.0% 0.0% 0.0% 60.53sec 4098405 301.42sec
baseline baseline life_tap 1454 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 37.59sec 0 301.42sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.42sec
baseline baseline soul_harvest 196098 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.48sec 0 301.42sec
baseline baseline spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.46sec 0 301.42sec
baseline baseline spectral_blast 246442 6803838 22572 6.55 166513 332617 33.1 32.9 24.2% 0.0% 0.0% 0.0% 8.08sec 6803838 301.42sec
baseline baseline spectral_bolt 242571 15214331 50475 17.01 143208 286534 85.8 85.4 24.3% 0.0% 0.0% 0.0% 3.05sec 15214331 301.42sec
baseline baseline summon_doomguard 18540 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.42sec
baseline baseline summon_infernal 1122 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 301.42sec
baseline baseline_infernal immolation ticks -19483 144611 482 0.40 58284 116685 1.0 2.0 24.0% 0.0% 0.0% 0.0% 0.00sec 144611 3.22sec
baseline baseline_infernal melee 0 87124 27034 37.24 34917 69849 2.0 2.0 24.7% 0.0% 0.0% 0.0% 1.19sec 128081 3.22sec
baseline baseline_infernal meteor_strike 171018 111341 34549 18.62 89695 179339 1.0 1.0 24.1% 0.0% 0.0% 0.0% 0.00sec 111341 3.22sec
baseline baseline_doomguard doom_bolt 85692 46363534 155477 26.88 276255 551416 134.3 133.6 25.7% 0.0% 0.0% 0.0% 2.22sec 46363534 298.20sec
baseline baseline_lord_of_flames_infernal immolation ticks -19483 5163397 17211 13.20 62945 125858 3.0 66.0 24.3% 0.0% 0.0% 0.0% 0.00sec 5163397 25.00sec
baseline baseline_lord_of_flames_infernal melee 0 3091252 123645 158.39 37696 75379 66.0 66.0 24.3% 0.0% 0.0% 0.0% 1.12sec 4544433 25.00sec
baseline baseline_shadowy_tear shadow_bolt ticks -196657 7720868 25736 7.20 172345 344028 3.6 36.0 25.2% 0.0% 0.0% 0.0% 68.02sec 7720868 44.74sec
baseline baseline_flame_rift searing_bolt 243050 6402019 72545 47.90 90864 0 70.8 70.5 0.0% 0.0% 0.0% 0.0% 2.63sec 21109384 88.25sec
baseline baseline_flame_rift searing_bolt ticks -243050 14707365 49025 22.29 105464 210016 70.8 111.5 25.3% 0.0% 0.0% 0.0% 2.63sec 21109384 88.25sec
baseline baseline_chaos_tear chaos_bolt 215279 6457567 368602 12.19 0 1814409 3.6 3.6 100.0% 0.0% 0.0% 0.0% 68.01sec 6457567 17.52sec
baseline baseline_chaos_portal chaos_barrage ticks -187394 6974850 23250 22.43 49907 99380 3.6 112.2 25.4% 0.0% 0.0% 0.0% 66.58sec 6974850 18.88sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
1332145.7 1332145.7 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.16% 10.16% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.16%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 11.00% 11.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:11.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.18% 11.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.72% 11.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.64% 10.64% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.64%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.36% 10.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.36%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.05% 12.05% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.05%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.73% 10.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.10% 7.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.08% 5.08% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.08%

Trigger Attempt Success

  • trigger_pct:100.00%
Eradication 2.4 3.7 18.5sec 7.2sec 11.69% 11.69% 3.7(3.7) 2.2

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:11.69%

Trigger Attempt Success

  • trigger_pct:14.30%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=7 seconds}.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 2.8 4.3 18.4sec 7.2sec 13.62% 13.62% 4.3(4.3) 2.6

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:13.62%

Trigger Attempt Success

  • trigger_pct:16.67%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=7 seconds}.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 3.4 5.3 17.9sec 6.9sec 16.08% 16.08% 5.3(5.3) 3.2

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:16.08%

Trigger Attempt Success

  • trigger_pct:20.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=7 seconds}.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 4.1 7.2 18.5sec 6.7sec 20.52% 20.52% 7.2(7.2) 3.9

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:20.52%

Trigger Attempt Success

  • trigger_pct:25.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=7 seconds}.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 5.9 7.8 17.2sec 7.4sec 25.41% 25.41% 7.8(7.8) 5.6

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:25.41%

Trigger Attempt Success

  • trigger_pct:33.33%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=7 seconds}.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 8.9 10.3 17.2sec 7.9sec 37.85% 37.85% 10.3(10.3) 8.4

Buff details

  • buff initial source:baseline
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:37.85%

Trigger Attempt Success

  • trigger_pct:50.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=7 seconds}.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Eradication 18.3 21.2 16.8sec 7.7sec 74.04% 74.04% 21.2(21.2) 17.4

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_eradication
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • eradication_1:74.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196414
  • name:Eradication
  • tooltip:Damage taken from the Warlock increased by $s1%.
  • description:{$@spelldesc196412=Chaos Bolt increases the damage you deal to the target by $196414s1% for {$196414d=7 seconds}.}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 1332145.70
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 17524
death count pct 700.96
avg death time 301.23
min death time 209.85
max death time 422.70
dmg taken 401862216.04

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 17481
Mean 301.25
Minimum 209.85
Maximum 422.70
Spread ( max - min ) 212.85
Range [ ( max - min ) / 2 * 100% ] 35.33%
Standard Deviation 41.2387
5th Percentile 240.33
95th Percentile 367.17
( 95th Percentile - 5th Percentile ) 126.84
Mean Distribution
Standard Deviation 0.3119
95.00% Confidence Intervall ( 300.64 - 301.86 )
Normalized 95.00% Confidence Intervall ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 720
0.1% Error 71986
0.1 Scale Factor Error with Delta=300 15
0.05 Scale Factor Error with Delta=300 59
0.01 Scale Factor Error with Delta=300 1452
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 17481
Mean 1338591.44
Minimum 1064860.19
Maximum 1584274.15
Spread ( max - min ) 519413.96
Range [ ( max - min ) / 2 * 100% ] 19.40%
Standard Deviation 60273.4626
5th Percentile 1243000.40
95th Percentile 1440355.87
( 95th Percentile - 5th Percentile ) 197355.46
Mean Distribution
Standard Deviation 455.8721
95.00% Confidence Intervall ( 1337697.95 - 1339484.93 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 78
0.1% Error 7789
0.1 Scale Factor Error with Delta=300 31012442
0.05 Scale Factor Error with Delta=300 124049765
0.01 Scale Factor Error with Delta=300 3101244103
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 470434153 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=113
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.